prot_H-paniculata_contig14253.2580.1 (polypeptide) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig14253.2580.1 vs. uniprot
Match: D7FIE1_ECTSI (EsV-1-7 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FIE1_ECTSI) HSP 1 Score: 55.8 bits (133), Expect = 3.080e-5 Identity = 26/44 (59.09%), Postives = 31/44 (70.45%), Query Frame = 0 Query: 3 QRKRKLCSHEGCPKRPSYGLGGTGKAEICAQHAEKGMVNVRSQR 46 Q+ R C GC K PSYG G+ K E CAQHA+KGMVN+RS+R Sbjct: 103 QQWRPCCKEHGCTKWPSYGGAGSKKVEFCAQHAKKGMVNLRSRR 146 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig14253.2580.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-paniculata_contig14253.2580.1 ID=prot_H-paniculata_contig14253.2580.1|Name=mRNA_H-paniculata_contig14253.2580.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=361bpback to top |