mRNA_H-paniculata_contig13806.2337.1 (mRNA) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig13806.2337.1 vs. uniprot
Match: A0A6H5JCA8_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JCA8_9PHAE) HSP 1 Score: 62.4 bits (150), Expect = 2.210e-10 Identity = 28/34 (82.35%), Postives = 32/34 (94.12%), Query Frame = 1 Query: 1 REQLGGNKFLLSDGLFIAKSLNRTLVEYPVKDAR 102 REQLGGNKFL+SDG+F+AK+L RT VEYPVKDAR Sbjct: 247 REQLGGNKFLVSDGIFMAKALGRTFVEYPVKDAR 280
BLAST of mRNA_H-paniculata_contig13806.2337.1 vs. uniprot
Match: D8LN55_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LN55_ECTSI) HSP 1 Score: 61.2 bits (147), Expect = 5.670e-10 Identity = 27/34 (79.41%), Postives = 32/34 (94.12%), Query Frame = 1 Query: 1 REQLGGNKFLLSDGLFIAKSLNRTLVEYPVKDAR 102 REQLGGNKFL++DG+F+AK+L RT VEYPVKDAR Sbjct: 122 REQLGGNKFLVTDGIFMAKALGRTFVEYPVKDAR 155
BLAST of mRNA_H-paniculata_contig13806.2337.1 vs. uniprot
Match: D8LFR0_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LFR0_ECTSI) HSP 1 Score: 57.8 bits (138), Expect = 9.440e-9 Identity = 26/34 (76.47%), Postives = 32/34 (94.12%), Query Frame = 1 Query: 1 REQLGGNKFLLSDGLFIAKSLNRTLVEYPVKDAR 102 REQLG N++LLSDGL+IAK+LNRTLVE+PV +AR Sbjct: 154 REQLGSNRYLLSDGLYIAKTLNRTLVEFPVANAR 187
BLAST of mRNA_H-paniculata_contig13806.2337.1 vs. uniprot
Match: A0A6H5KP62_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KP62_9PHAE) HSP 1 Score: 57.8 bits (138), Expect = 9.440e-9 Identity = 26/34 (76.47%), Postives = 32/34 (94.12%), Query Frame = 1 Query: 1 REQLGGNKFLLSDGLFIAKSLNRTLVEYPVKDAR 102 REQLG N++LLSDGL+IAK+LNRTLVE+PV +AR Sbjct: 152 REQLGSNRYLLSDGLYIAKTLNRTLVEFPVANAR 185 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig13806.2337.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 4
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-paniculata_contig13806.2337.1 >prot_H-paniculata_contig13806.2337.1 ID=prot_H-paniculata_contig13806.2337.1|Name=mRNA_H-paniculata_contig13806.2337.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=34bp REQLGGNKFLLSDGLFIAKSLNRTLVEYPVKDARback to top mRNA from alignment at H-paniculata_contig13806:6503..6604- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-paniculata_contig13806.2337.1 ID=mRNA_H-paniculata_contig13806.2337.1|Name=mRNA_H-paniculata_contig13806.2337.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=mRNA|length=102bp|location=Sequence derived from alignment at H-paniculata_contig13806:6503..6604- (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top Coding sequence (CDS) from alignment at H-paniculata_contig13806:6503..6604- >mRNA_H-paniculata_contig13806.2337.1 ID=mRNA_H-paniculata_contig13806.2337.1|Name=mRNA_H-paniculata_contig13806.2337.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=CDS|length=204bp|location=Sequence derived from alignment at H-paniculata_contig13806:6503..6604- (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top |