mRNA_H-paniculata_contig13720.2292.1 (mRNA) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig13720.2292.1 vs. uniprot
Match: A0A835ZFI0_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835ZFI0_9STRA) HSP 1 Score: 72.0 bits (175), Expect = 3.750e-13 Identity = 33/64 (51.56%), Postives = 46/64 (71.88%), Query Frame = 1 Query: 1 VRRLVASVVLANASDALLDERCFRQTLRVVSELWRGFRSHCKVELAVLLEGFLLRTLRAGSPQV 192 +RRLV S+V+ +++ L+DER FR L +V+ LW+ FR HCKVELAVL+E +L+ LR G V Sbjct: 1402 IRRLVVSLVINISAEVLMDERIFRLVLELVTALWKRFRRHCKVELAVLMENLVLKLLREGGGAV 1465
BLAST of mRNA_H-paniculata_contig13720.2292.1 vs. uniprot
Match: B7G9T2_PHATC (Predicted protein n=1 Tax=Phaeodactylum tricornutum (strain CCAP 1055/1) TaxID=556484 RepID=B7G9T2_PHATC) HSP 1 Score: 61.2 bits (147), Expect = 2.350e-9 Identity = 31/68 (45.59%), Postives = 45/68 (66.18%), Query Frame = 1 Query: 1 VRRLVASVVLANASDALLDERCFRQTLRVVSELWRG--FRSHCKVELAVLLEGFLLRTLRAGSPQVMY 198 +RR+V +L N AL D + F++ +R+VSELW +RSHCKVEL VL+E + +R L G PQ ++ Sbjct: 1015 IRRMVVPCLLENTRHALEDPQIFQRVVRIVSELWSSPIYRSHCKVELGVLMEHYGVRILNLG-PQFLF 1081
BLAST of mRNA_H-paniculata_contig13720.2292.1 vs. uniprot
Match: A0A7S2LRX7_9STRA (Hypothetical protein (Fragment) n=1 Tax=Skeletonema marinoi TaxID=267567 RepID=A0A7S2LRX7_9STRA) HSP 1 Score: 50.4 bits (119), Expect = 1.460e-5 Identity = 26/66 (39.39%), Postives = 43/66 (65.15%), Query Frame = 1 Query: 1 VRRLVASVVLANASDALLDERCFRQTLRVVSELWRG--FRSHCKVELAVLLEGFLLRTLRAGSPQV 192 +RR+V +L+N S ++ D R +++ LR+ S LW +R KV+LA+L+E F+L+ L G PQ+ Sbjct: 245 IRRMVVPTMLSNTSASIEDCRVYQRVLRITSHLWCNSYYRRKMKVDLAILIEHFVLKILCLG-PQI 309 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig13720.2292.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-paniculata_contig13720.2292.1 >prot_H-paniculata_contig13720.2292.1 ID=prot_H-paniculata_contig13720.2292.1|Name=mRNA_H-paniculata_contig13720.2292.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=66bp VRRLVASVVLANASDALLDERCFRQTLRVVSELWRGFRSHCKVELAVLLEback to top mRNA from alignment at H-paniculata_contig13720:5842..6039+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-paniculata_contig13720.2292.1 ID=mRNA_H-paniculata_contig13720.2292.1|Name=mRNA_H-paniculata_contig13720.2292.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=mRNA|length=198bp|location=Sequence derived from alignment at H-paniculata_contig13720:5842..6039+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top Coding sequence (CDS) from alignment at H-paniculata_contig13720:5842..6039+ >mRNA_H-paniculata_contig13720.2292.1 ID=mRNA_H-paniculata_contig13720.2292.1|Name=mRNA_H-paniculata_contig13720.2292.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=CDS|length=396bp|location=Sequence derived from alignment at H-paniculata_contig13720:5842..6039+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top |