mRNA_H-paniculata_contig13695.2272.1 (mRNA) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig13695.2272.1 vs. uniprot
Match: D8LNS7_ECTSI (Mitogen-activated protein kinase (Fragment) n=2 Tax=Ectocarpus TaxID=2879 RepID=D8LNS7_ECTSI) HSP 1 Score: 119 bits (298), Expect = 3.710e-30 Identity = 54/57 (94.74%), Postives = 55/57 (96.49%), Query Frame = 1 Query: 1 KLGVSGWTERWFVLEGKRVMYYNQRGDRHPRGTLELNAGSRLKKIPTKEHAFHVVSD 171 K GVSGWTERWFVLEGKRVMYYNQ+GDRHPRGTLELNAGSRLKKI TKEHAFHVVSD Sbjct: 7 KKGVSGWTERWFVLEGKRVMYYNQKGDRHPRGTLELNAGSRLKKIATKEHAFHVVSD 63
BLAST of mRNA_H-paniculata_contig13695.2272.1 vs. uniprot
Match: A0A835Z2Y5_9STRA (Mitogen-activated protein kinase n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835Z2Y5_9STRA) HSP 1 Score: 64.3 bits (155), Expect = 1.290e-10 Identity = 27/57 (47.37%), Postives = 38/57 (66.67%), Query Frame = 1 Query: 1 KLGVSGWTERWFVLEGKRVMYYNQRGDRHPRGTLELNAGSRLKKIPTKEHAFHVVSD 171 K G W +RWF LE V YY+++GD PRG + LNA SR+ +PT+ HAF V+++ Sbjct: 17 KKGGVSWKKRWFTLEDHVVTYYSRQGDPKPRGRMVLNAESRVTNLPTRPHAFQVITN 73
BLAST of mRNA_H-paniculata_contig13695.2272.1 vs. uniprot
Match: D8LNL4_ECTSI (Mitogen-activated protein kinase n=2 Tax=Ectocarpus TaxID=2879 RepID=D8LNL4_ECTSI) HSP 1 Score: 58.9 bits (141), Expect = 1.030e-8 Identity = 24/57 (42.11%), Postives = 37/57 (64.91%), Query Frame = 1 Query: 1 KLGVSGWTERWFVLEGKRVMYYNQRGDRHPRGTLELNAGSRLKKIPTKEHAFHVVSD 171 K G W RWF+LE + Y++++GD PRG + L A SR+ +PT+ HAF V+++ Sbjct: 24 KKGGVQWKRRWFILEDHVITYFSKQGDLRPRGRMVLIAESRVTNLPTRVHAFQVITN 80 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig13695.2272.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-paniculata_contig13695.2272.1 >prot_H-paniculata_contig13695.2272.1 ID=prot_H-paniculata_contig13695.2272.1|Name=mRNA_H-paniculata_contig13695.2272.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=57bp KLGVSGWTERWFVLEGKRVMYYNQRGDRHPRGTLELNAGSRLKKIPTKEHback to top mRNA from alignment at H-paniculata_contig13695:207..377+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-paniculata_contig13695.2272.1 ID=mRNA_H-paniculata_contig13695.2272.1|Name=mRNA_H-paniculata_contig13695.2272.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=mRNA|length=171bp|location=Sequence derived from alignment at H-paniculata_contig13695:207..377+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top Coding sequence (CDS) from alignment at H-paniculata_contig13695:207..377+ >mRNA_H-paniculata_contig13695.2272.1 ID=mRNA_H-paniculata_contig13695.2272.1|Name=mRNA_H-paniculata_contig13695.2272.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=CDS|length=342bp|location=Sequence derived from alignment at H-paniculata_contig13695:207..377+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top |