mRNA_H-paniculata_contig13670.2259.1 (mRNA) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig13670.2259.1 vs. uniprot
Match: A0A150G0E4_GONPE (Uncharacterized protein n=1 Tax=Gonium pectorale TaxID=33097 RepID=A0A150G0E4_GONPE) HSP 1 Score: 57.4 bits (137), Expect = 5.680e-8 Identity = 28/51 (54.90%), Postives = 34/51 (66.67%), Query Frame = 1 Query: 4 PGEMGDNLADVDLGTDRTAVHITCGRWHTCVVLDNEAVKT-SRGSSGHLSH 153 PGEMGDNL VDLGT RTAV + G +HTC +LD VK R ++G L + Sbjct: 13 PGEMGDNLPFVDLGTGRTAVAMAAGAYHTCAILDTARVKCWGRAANGQLGY 63
BLAST of mRNA_H-paniculata_contig13670.2259.1 vs. uniprot
Match: A0A830HF57_9CHLO (U-box domain-containing protein n=1 Tax=Pycnococcus provasolii TaxID=41880 RepID=A0A830HF57_9CHLO) HSP 1 Score: 57.4 bits (137), Expect = 6.560e-8 Identity = 29/52 (55.77%), Postives = 33/52 (63.46%), Query Frame = 1 Query: 1 EPGEMGDNLADVDLGTDRTAVHITCGRWHTCVVLDNEAVKT-SRGSSGHLSH 153 +PGE+GDNL VDLGT RTA+ I G HTC VLDN VK G G L + Sbjct: 474 DPGEVGDNLPIVDLGTGRTAIQIALGSHHTCAVLDNGGVKCWGLGRQGQLGY 525
BLAST of mRNA_H-paniculata_contig13670.2259.1 vs. uniprot
Match: A0A6H5JPT1_9PHAE (Protein kinase domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JPT1_9PHAE) HSP 1 Score: 57.0 bits (136), Expect = 8.990e-8 Identity = 24/36 (66.67%), Postives = 31/36 (86.11%), Query Frame = 1 Query: 4 PGEMGDNLADVDLGTDRTAVHITCGRWHTCVVLDNE 111 PG+MGDNL +VDLGT+RTAV + G +HTCV+LDN+ Sbjct: 182 PGQMGDNLPEVDLGTNRTAVALETGWYHTCVILDNK 217
BLAST of mRNA_H-paniculata_contig13670.2259.1 vs. uniprot
Match: UPI001056704E (hypothetical protein n=1 Tax=Legionella yabuuchiae TaxID=376727 RepID=UPI001056704E) HSP 1 Score: 56.6 bits (135), Expect = 1.200e-7 Identity = 29/50 (58.00%), Postives = 33/50 (66.00%), Query Frame = 1 Query: 1 EPGEMGDNLADVDLGTDRTAVHITCGRWHTCVVLDNEAVKT-SRGSSGHL 147 EPGEMGDNL VDLGT RTA +T G C +LDN+ VK R +SG L Sbjct: 332 EPGEMGDNLPAVDLGTGRTAKQLTAGGGFNCTLLDNDTVKCWGRNTSGQL 381
BLAST of mRNA_H-paniculata_contig13670.2259.1 vs. uniprot
Match: A0A835T094_9CHLO (Uncharacterized protein n=1 Tax=Chlamydomonas schloesseri TaxID=2026947 RepID=A0A835T094_9CHLO) HSP 1 Score: 56.6 bits (135), Expect = 1.240e-7 Identity = 25/39 (64.10%), Postives = 29/39 (74.36%), Query Frame = 1 Query: 4 PGEMGDNLADVDLGTDRTAVHITCGRWHTCVVLDNEAVK 120 PGEMGD L V+LGT RTA I+ G WHTC +LDN +VK Sbjct: 1851 PGEMGDTLPAVELGTGRTATAISAGGWHTCALLDNGSVK 1889
BLAST of mRNA_H-paniculata_contig13670.2259.1 vs. uniprot
Match: A0A7C1YRK2_9ACTN (Uncharacterized protein n=1 Tax=Acidimicrobiales bacterium TaxID=2201156 RepID=A0A7C1YRK2_9ACTN) HSP 1 Score: 55.5 bits (132), Expect = 3.100e-7 Identity = 29/51 (56.86%), Postives = 33/51 (64.71%), Query Frame = 1 Query: 4 PGEMGDNLADVDLGTDRTAVHITCGRWHTCVVLDNEAVKT-SRGSSGHLSH 153 PGEMGDNL VDLGT RTA I+ G HTC +LD+ VK GS G L + Sbjct: 213 PGEMGDNLPAVDLGTGRTATAISAGSSHTCALLDDGTVKCWGSGSFGRLGY 263
BLAST of mRNA_H-paniculata_contig13670.2259.1 vs. uniprot
Match: D7FKP6_ECTSI (Protein kinase domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FKP6_ECTSI) HSP 1 Score: 55.5 bits (132), Expect = 3.150e-7 Identity = 24/36 (66.67%), Postives = 30/36 (83.33%), Query Frame = 1 Query: 4 PGEMGDNLADVDLGTDRTAVHITCGRWHTCVVLDNE 111 PG+MGDNL +VDLGT+RTAV + G HTCV+LDN+ Sbjct: 280 PGQMGDNLPEVDLGTNRTAVALETGWHHTCVILDNK 315
BLAST of mRNA_H-paniculata_contig13670.2259.1 vs. uniprot
Match: A0A7C1UEQ2_9ACTN (Uncharacterized protein (Fragment) n=1 Tax=Acidimicrobiales bacterium TaxID=2201156 RepID=A0A7C1UEQ2_9ACTN) HSP 1 Score: 55.1 bits (131), Expect = 4.210e-7 Identity = 25/40 (62.50%), Postives = 30/40 (75.00%), Query Frame = 1 Query: 1 EPGEMGDNLADVDLGTDRTAVHITCGRWHTCVVLDNEAVK 120 EPGEMGDNL VDLGT RTA+ ++ G+ TC +LDN VK Sbjct: 339 EPGEMGDNLPPVDLGTGRTAIAVSTGQEFTCALLDNGTVK 378
BLAST of mRNA_H-paniculata_contig13670.2259.1 vs. uniprot
Match: A0A7C1YKS1_9ACTN (Fibronectin type-III domain-containing protein (Fragment) n=1 Tax=Acidimicrobiales bacterium TaxID=2201156 RepID=A0A7C1YKS1_9ACTN) HSP 1 Score: 55.1 bits (131), Expect = 4.240e-7 Identity = 24/39 (61.54%), Postives = 29/39 (74.36%), Query Frame = 1 Query: 4 PGEMGDNLADVDLGTDRTAVHITCGRWHTCVVLDNEAVK 120 PGEMGDNL +DLGT RTAV I G HTC +LD+ ++K Sbjct: 204 PGEMGDNLPSIDLGTGRTAVAIAAGSHHTCAILDDGSLK 242
BLAST of mRNA_H-paniculata_contig13670.2259.1 vs. uniprot
Match: A0A150FY78_GONPE (Uncharacterized protein n=1 Tax=Gonium pectorale TaxID=33097 RepID=A0A150FY78_GONPE) HSP 1 Score: 52.8 bits (125), Expect = 4.950e-7 Identity = 24/39 (61.54%), Postives = 26/39 (66.67%), Query Frame = 1 Query: 4 PGEMGDNLADVDLGTDRTAVHITCGRWHTCVVLDNEAVK 120 PGEMGDNL VDLGT RT + G +HTC VLDN K Sbjct: 8 PGEMGDNLFYVDLGTGRTVAALAAGAYHTCAVLDNGKAK 46 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig13670.2259.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-paniculata_contig13670.2259.1 >prot_H-paniculata_contig13670.2259.1 ID=prot_H-paniculata_contig13670.2259.1|Name=mRNA_H-paniculata_contig13670.2259.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=67bp MGDNLADVDLGTDRTAVHITCGRWHTCVVLDNEAVKTSRGSSGHLSHLLSback to top mRNA from alignment at H-paniculata_contig13670:4184..4727- Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-paniculata_contig13670.2259.1 ID=mRNA_H-paniculata_contig13670.2259.1|Name=mRNA_H-paniculata_contig13670.2259.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=mRNA|length=544bp|location=Sequence derived from alignment at H-paniculata_contig13670:4184..4727- (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top Coding sequence (CDS) from alignment at H-paniculata_contig13670:4184..4727- >mRNA_H-paniculata_contig13670.2259.1 ID=mRNA_H-paniculata_contig13670.2259.1|Name=mRNA_H-paniculata_contig13670.2259.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=CDS|length=402bp|location=Sequence derived from alignment at H-paniculata_contig13670:4184..4727- (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top |