prot_H-paniculata_contig136.2222.1 (polypeptide) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig136.2222.1 vs. uniprot
Match: D8LMJ3_ECTSI (Ankyrin repeat domain protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LMJ3_ECTSI) HSP 1 Score: 114 bits (284), Expect = 5.100e-25 Identity = 56/90 (62.22%), Postives = 68/90 (75.56%), Query Frame = 0 Query: 1 TKQRLKYHQGKQRFQAGRSIFSSTRVQEAVNEEWIKGGHRRRAMRMLLLFLAYMTVFTASSVLNSGRNEPHGFHLSMSVRTVLETGSELW 90 +QRL Y Q KQR+ AGRSIFSS RVQEAV+EEWI+GGHR RA+R+LLL+L Y+ VFT SVLNSGRN PHG+HL++ S+ W Sbjct: 486 ARQRLVYQQSKQRYHAGRSIFSSARVQEAVHEEWIQGGHRIRALRVLLLYLVYLVVFTLCSVLNSGRNMPHGYHLTIWYEGDTLVNSQGW 575 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig136.2222.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-paniculata_contig136.2222.1 ID=prot_H-paniculata_contig136.2222.1|Name=mRNA_H-paniculata_contig136.2222.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=251bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|