mRNA_H-paniculata_contig13530.2187.1 (mRNA) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig13530.2187.1 vs. uniprot
Match: A0A6H5JXW2_9PHAE (Glutamine amidotransferase type-2 domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JXW2_9PHAE) HSP 1 Score: 72.8 bits (177), Expect = 1.590e-13 Identity = 32/45 (71.11%), Postives = 39/45 (86.67%), Query Frame = 1 Query: 1 PCQFKRYTFMHNGGIPGFPQMKRALLSLLGEEAYEAIEGTTDSEV 135 P ++KRYTFMHNGGIPGF +MKR LL+ LG+EAY IEG+TDSE+ Sbjct: 103 PFKYKRYTFMHNGGIPGFARMKRQLLAQLGDEAYLTIEGSTDSEL 147
BLAST of mRNA_H-paniculata_contig13530.2187.1 vs. uniprot
Match: D8LKF2_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LKF2_ECTSI) HSP 1 Score: 71.6 bits (174), Expect = 4.090e-13 Identity = 31/45 (68.89%), Postives = 39/45 (86.67%), Query Frame = 1 Query: 1 PCQFKRYTFMHNGGIPGFPQMKRALLSLLGEEAYEAIEGTTDSEV 135 P ++KRYTFMHNGGIPGF +MKR LL+ LG+ AY A+EG+TDSE+ Sbjct: 109 PFKYKRYTFMHNGGIPGFARMKRQLLAQLGDAAYLAVEGSTDSEL 153
BLAST of mRNA_H-paniculata_contig13530.2187.1 vs. uniprot
Match: A0A1Y5T140_9RHOB (Amidohydrolase EgtC n=1 Tax=Pseudooctadecabacter jejudonensis TaxID=1391910 RepID=A0A1Y5T140_9RHOB) HSP 1 Score: 58.2 bits (139), Expect = 1.480e-8 Identity = 25/52 (48.08%), Postives = 37/52 (71.15%), Query Frame = 1 Query: 1 PCQFKRYTFMHNGGIPGFPQMKRALLSLLGEEAYEAIEGTTDSEVIVFRVVS 156 P + R+TFMHNG +P FPQ++RAL L +E Y A +GTTDSE++ +++ Sbjct: 101 PFKHGRWTFMHNGQVPHFPQIRRALEQALPDELYAARQGTTDSEMVFLTLLA 152
BLAST of mRNA_H-paniculata_contig13530.2187.1 vs. uniprot
Match: UPI0006448B37 (hypothetical protein n=1 Tax=Acytostelium subglobosum LB1 TaxID=1410327 RepID=UPI0006448B37) HSP 1 Score: 57.8 bits (138), Expect = 2.900e-8 Identity = 28/61 (45.90%), Postives = 43/61 (70.49%), Query Frame = 1 Query: 1 PCQFKRYTFMHNGGIPGFPQMKRALLSLLGEEAYEAIEGTTDSEVIVFRVVSLAISGYSVE 183 P FK +++MHNG + FP++KR +L++L + A+E+I+GTTDSE+ V +L IS Y E Sbjct: 103 PFTFKNFSWMHNGTVSYFPKLKRNILNMLTQTAFESIKGTTDSEM----VFALFISNYERE 159
BLAST of mRNA_H-paniculata_contig13530.2187.1 vs. uniprot
Match: A0A151ZGC8_9MYCE (Putative glutamine amidotransferase n=1 Tax=Tieghemostelium lacteum TaxID=361077 RepID=A0A151ZGC8_9MYCE) HSP 1 Score: 57.4 bits (137), Expect = 4.060e-8 Identity = 29/61 (47.54%), Postives = 41/61 (67.21%), Query Frame = 1 Query: 1 PCQFKRYTFMHNGGIPGFPQMKRALLSLLGEEAYEAIEGTTDSEVIVFRVVSLAISGYSVE 183 P FK +FMHNG I F ++KR++LS+L + A+E I+GTTDSEV+ +L I+ Y E Sbjct: 102 PFTFKNLSFMHNGTITYFSKLKRSILSMLSDTAFEMIKGTTDSEVLF----ALFITNYEKE 158
BLAST of mRNA_H-paniculata_contig13530.2187.1 vs. uniprot
Match: UPI0006450162 (hypothetical protein n=1 Tax=Acytostelium subglobosum LB1 TaxID=1410327 RepID=UPI0006450162) HSP 1 Score: 57.0 bits (136), Expect = 5.400e-8 Identity = 25/61 (40.98%), Postives = 44/61 (72.13%), Query Frame = 1 Query: 1 PCQFKRYTFMHNGGIPGFPQMKRALLSLLGEEAYEAIEGTTDSEVIVFRVVSLAISGYSVE 183 P +K +++MHNG + FP++KR L+++L + A+E+I+GTTD+EV+ +L I+ Y +E Sbjct: 107 PFTYKNFSWMHNGTVSYFPKIKRQLINMLSQTAFESIKGTTDTEVLF----ALFITNYEME 163
BLAST of mRNA_H-paniculata_contig13530.2187.1 vs. uniprot
Match: A0A7J9UZQ3_9MICO (Class II glutamine amidotransferase n=2 Tax=Georgenia TaxID=154116 RepID=A0A7J9UZQ3_9MICO) HSP 1 Score: 56.6 bits (135), Expect = 6.600e-8 Identity = 23/55 (41.82%), Postives = 39/55 (70.91%), Query Frame = 1 Query: 1 PCQFKRYTFMHNGGIPGFPQMKRALLSLLGEEAYEAIEGTTDSEVIVFRVVSLAI 165 P ++ R+ +MHNGGI GFP +KR L +++ + Y IEG+TDSEV+ + +++ + Sbjct: 101 PFRYGRWMWMHNGGITGFPHLKRDLDAVVDPDLYPYIEGSTDSEVLFYLALTMGL 155
BLAST of mRNA_H-paniculata_contig13530.2187.1 vs. uniprot
Match: A0A356KSB1_9BACT (Class II glutamine amidotransferase n=1 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A356KSB1_9BACT) HSP 1 Score: 56.6 bits (135), Expect = 6.670e-8 Identity = 29/58 (50.00%), Postives = 39/58 (67.24%), Query Frame = 1 Query: 1 PCQFKRYTFMHNGGIPGFPQMKRALLSLLGEEAYEAIEGTTDSEVIVFRVVSLAISGY 174 P ++ R +FMHNG I GF Q+KRAL + L +EAY I+G+TDSE + +LAI Y Sbjct: 103 PFRWGRLSFMHNGAIGGFTQLKRALQAKLSDEAYRWIQGSTDSE----HLFALAIDEY 156
BLAST of mRNA_H-paniculata_contig13530.2187.1 vs. uniprot
Match: A0A1R3X8A6_9RHOB (Glutamine amidotransferase n=2 Tax=Yoonia rosea TaxID=287098 RepID=A0A1R3X8A6_9RHOB) HSP 1 Score: 55.1 bits (131), Expect = 2.120e-7 Identity = 22/52 (42.31%), Postives = 39/52 (75.00%), Query Frame = 1 Query: 1 PCQFKRYTFMHNGGIPGFPQMKRALLSLLGEEAYEAIEGTTDSEVIVFRVVS 156 P +F +++F HNG IP F ++R +L+ L ++ +EA++GTTDSE+I F +++ Sbjct: 101 PFKFGKWSFCHNGQIPHFKAIRRRMLAALPDQLFEAMQGTTDSEMIFFTLLA 152
BLAST of mRNA_H-paniculata_contig13530.2187.1 vs. uniprot
Match: UPI0019333DA8 (class II glutamine amidotransferase n=1 Tax=Skermanella rosea TaxID=1817965 RepID=UPI0019333DA8) HSP 1 Score: 54.3 bits (129), Expect = 4.390e-7 Identity = 23/56 (41.07%), Postives = 40/56 (71.43%), Query Frame = 1 Query: 1 PCQFKRYTFMHNGGIPGFPQMKRALLSLLGEEAYEAIEGTTDSEVIVFRVVSLAIS 168 P +F R+ FMHNG I G+P ++RA+ +L+ ++ Y EG+TDSEVI + +++ ++ Sbjct: 101 PFRFDRWLFMHNGQIGGWPVVRRAVENLIADDLYPFREGSTDSEVIFYLLLTNGVA 156 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig13530.2187.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-paniculata_contig13530.2187.1 >prot_H-paniculata_contig13530.2187.1 ID=prot_H-paniculata_contig13530.2187.1|Name=mRNA_H-paniculata_contig13530.2187.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=52bp MHNGGIPGFPQMKRALLSLLGEEAYEAIEGTTDSEVIVFRVVSLAISGYSback to top mRNA from alignment at H-paniculata_contig13530:265..447+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-paniculata_contig13530.2187.1 ID=mRNA_H-paniculata_contig13530.2187.1|Name=mRNA_H-paniculata_contig13530.2187.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=mRNA|length=183bp|location=Sequence derived from alignment at H-paniculata_contig13530:265..447+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top Coding sequence (CDS) from alignment at H-paniculata_contig13530:265..447+ >mRNA_H-paniculata_contig13530.2187.1 ID=mRNA_H-paniculata_contig13530.2187.1|Name=mRNA_H-paniculata_contig13530.2187.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=CDS|length=312bp|location=Sequence derived from alignment at H-paniculata_contig13530:265..447+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top |