prot_H-paniculata_contig13169.1982.1 (polypeptide) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig13169.1982.1 vs. uniprot
Match: D7G9D8_ECTSI (MutL protein homolog 3 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G9D8_ECTSI) HSP 1 Score: 64.7 bits (156), Expect = 7.010e-11 Identity = 28/42 (66.67%), Postives = 33/42 (78.57%), Query Frame = 0 Query: 1 VVRGGETLHCGPSSTPLQQGTVVTLRDVFYRWPVRRKAMNPV 42 VVR GE LH GPS P++ GT+VTLRD F++WPVRRKA N V Sbjct: 136 VVREGEVLHFGPSRAPVRAGTIVTLRDAFFKWPVRRKAANEV 177
BLAST of mRNA_H-paniculata_contig13169.1982.1 vs. uniprot
Match: A0A6H5JWV7_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JWV7_9PHAE) HSP 1 Score: 63.9 bits (154), Expect = 1.310e-10 Identity = 28/42 (66.67%), Postives = 32/42 (76.19%), Query Frame = 0 Query: 1 VVRGGETLHCGPSSTPLQQGTVVTLRDVFYRWPVRRKAMNPV 42 VVR GE LH GPS P + GT+VTLRD F++WPVRRKA N V Sbjct: 87 VVREGEVLHFGPSRAPARAGTIVTLRDAFFKWPVRRKAANEV 128
BLAST of mRNA_H-paniculata_contig13169.1982.1 vs. uniprot
Match: A0A1Y2EVX0_9BASI (Uncharacterized protein n=1 Tax=Leucosporidium creatinivorum TaxID=106004 RepID=A0A1Y2EVX0_9BASI) HSP 1 Score: 50.8 bits (120), Expect = 5.480e-6 Identity = 23/41 (56.10%), Postives = 31/41 (75.61%), Query Frame = 0 Query: 1 VVRGGETLHCGPSSTP-LQQGTVVTLRDVFYRWPVRRKAMN 40 V RGGE L+ G +STP +GT V +RD+FY+WPVRRK ++ Sbjct: 141 VARGGERLYEGVASTPRATEGTTVWVRDIFYKWPVRRKPLS 181 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig13169.1982.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 3
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-paniculata_contig13169.1982.1 ID=prot_H-paniculata_contig13169.1982.1|Name=mRNA_H-paniculata_contig13169.1982.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=50bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|