mRNA_H-paniculata_contig13036.1902.1 (mRNA) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig13036.1902.1 vs. uniprot
Match: A0A6H5L245_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L245_9PHAE) HSP 1 Score: 86.7 bits (213), Expect = 1.420e-19 Identity = 34/48 (70.83%), Postives = 42/48 (87.50%), Query Frame = 1 Query: 1 GFKQCEGHPPCEICSTHTEPWCNARLFLEENMFNAHVGKSLYAMQLQR 144 G KQC G PPCE+C+THTEPWCN R++L E ++NAHVGKS+YAMQL+R Sbjct: 84 GRKQCNGRPPCELCNTHTEPWCNPRVYLGEILYNAHVGKSVYAMQLRR 131
BLAST of mRNA_H-paniculata_contig13036.1902.1 vs. uniprot
Match: D7FHD4_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FHD4_ECTSI) HSP 1 Score: 86.7 bits (213), Expect = 1.260e-18 Identity = 34/48 (70.83%), Postives = 42/48 (87.50%), Query Frame = 1 Query: 1 GFKQCEGHPPCEICSTHTEPWCNARLFLEENMFNAHVGKSLYAMQLQR 144 G KQC G PPCE+C+THTEPWCN R++L E ++NAHVGKS+YAMQL+R Sbjct: 481 GRKQCNGRPPCELCNTHTEPWCNPRVYLGEVLYNAHVGKSVYAMQLRR 528 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig13036.1902.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-paniculata_contig13036.1902.1 >prot_H-paniculata_contig13036.1902.1 ID=prot_H-paniculata_contig13036.1902.1|Name=mRNA_H-paniculata_contig13036.1902.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=49bp GFKQCEGHPPCEICSTHTEPWCNARLFLEENMFNAHVGKSLYAMQLQR*back to top mRNA from alignment at H-paniculata_contig13036:592..1674+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-paniculata_contig13036.1902.1 ID=mRNA_H-paniculata_contig13036.1902.1|Name=mRNA_H-paniculata_contig13036.1902.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=mRNA|length=1083bp|location=Sequence derived from alignment at H-paniculata_contig13036:592..1674+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top Coding sequence (CDS) from alignment at H-paniculata_contig13036:592..1674+ >mRNA_H-paniculata_contig13036.1902.1 ID=mRNA_H-paniculata_contig13036.1902.1|Name=mRNA_H-paniculata_contig13036.1902.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=CDS|length=294bp|location=Sequence derived from alignment at H-paniculata_contig13036:592..1674+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top |