prot_H-paniculata_contig12521.1586.1 (polypeptide) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig12521.1586.1 vs. uniprot
Match: A0A6H5L4A6_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L4A6_9PHAE) HSP 1 Score: 109 bits (273), Expect = 1.210e-26 Identity = 48/75 (64.00%), Postives = 67/75 (89.33%), Query Frame = 0 Query: 1 MVEENKFVREQAQEKYCRTHDFDLIAGTYYDQKKEQDFLRTRETLMTLQGQAQQHRLPPSMRYGEGNEYDIINKE 75 M EE +F+RE+A+EKY RTHD+++IAG YYDQ KE++F+ +RE L+T+QG+AQQ+RLPPS+RYGEGN Y+IIN++ Sbjct: 134 MTEEKRFLRERAEEKYRRTHDYNIIAGAYYDQDKEREFVNSREKLLTMQGRAQQYRLPPSIRYGEGNGYNIINQQ 208
BLAST of mRNA_H-paniculata_contig12521.1586.1 vs. uniprot
Match: D8LS80_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LS80_ECTSI) HSP 1 Score: 107 bits (267), Expect = 3.300e-26 Identity = 47/75 (62.67%), Postives = 66/75 (88.00%), Query Frame = 0 Query: 1 MVEENKFVREQAQEKYCRTHDFDLIAGTYYDQKKEQDFLRTRETLMTLQGQAQQHRLPPSMRYGEGNEYDIINKE 75 M EE +F+RE+A+EKY RTHD+++IAG YYDQ KE+ F+ +R+ L+T+QG+AQQ+RLPPS+RYGEGN Y+IIN++ Sbjct: 55 MTEEKRFLRERAEEKYRRTHDYNIIAGAYYDQDKERKFVNSRDKLLTMQGRAQQYRLPPSIRYGEGNGYNIINQQ 129
BLAST of mRNA_H-paniculata_contig12521.1586.1 vs. uniprot
Match: A0A482T1S9_9ARCH (Uncharacterized protein n=1 Tax=archaeon TaxID=1906665 RepID=A0A482T1S9_9ARCH) HSP 1 Score: 62.4 bits (150), Expect = 1.550e-9 Identity = 25/62 (40.32%), Postives = 42/62 (67.74%), Query Frame = 0 Query: 15 KYCRTHDFDLIAGTYYDQKKEQDFLRTRETLMTLQGQAQQHRLPPSMRYGEGNEYDIINKEV 76 KY HD+D+I G +Y +K++ + ET+ ++QG AQ RLPPS++Y +GN Y+++ +V Sbjct: 151 KYWDNHDYDMIKGRFYSPEKQKLYEEHLETIKSVQGTAQMERLPPSLKYSDGNSYNLLTHDV 212
BLAST of mRNA_H-paniculata_contig12521.1586.1 vs. uniprot
Match: A0A1W0A3C8_9STRA (Gamma-tubulin complex component n=1 Tax=Thraustotheca clavata TaxID=74557 RepID=A0A1W0A3C8_9STRA) HSP 1 Score: 55.1 bits (131), Expect = 6.200e-7 Identity = 23/62 (37.10%), Postives = 39/62 (62.90%), Query Frame = 0 Query: 15 KYCRTHDFDLIAGTYYDQKKEQDFLRTRETLMTLQGQAQQHRLPPSMRYGEGNEYDIINKEV 76 K+ +THDF+ + G YYD KE++FL+ R+ + G + +LP +Y G Y+IIN+++ Sbjct: 1273 KFNQTHDFNPLLGQYYDNDKEENFLKVRDAKAKVHGVGRDDKLPYGEQYSAGRLYNIINQQI 1334 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig12521.1586.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 4
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-paniculata_contig12521.1586.1 ID=prot_H-paniculata_contig12521.1586.1|Name=mRNA_H-paniculata_contig12521.1586.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=80bpback to top |