prot_H-paniculata_contig1240.1513.1 (polypeptide) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig1240.1513.1 vs. uniprot
Match: D7G2I9_ECTSI (Coiled-coil domain-containing protein 86 n=2 Tax=Ectocarpus TaxID=2879 RepID=D7G2I9_ECTSI) HSP 1 Score: 63.5 bits (153), Expect = 5.640e-11 Identity = 29/32 (90.62%), Postives = 32/32 (100.00%), Query Frame = 0 Query: 1 MSKKQLRQIKKRQVNSRTGEIEFVSPWGGGQK 32 MSKKQLRQIKKRQ+NSRTGE+EFVSPWGGG+K Sbjct: 232 MSKKQLRQIKKRQINSRTGEVEFVSPWGGGKK 263
BLAST of mRNA_H-paniculata_contig1240.1513.1 vs. uniprot
Match: A0A7S2SQP8_9STRA (Coiled-coil domain-containing protein 86 n=1 Tax=Rhizochromulina marina TaxID=1034831 RepID=A0A7S2SQP8_9STRA) HSP 1 Score: 48.9 bits (115), Expect = 2.920e-6 Identity = 22/27 (81.48%), Postives = 25/27 (92.59%), Query Frame = 0 Query: 1 MSKKQLRQIKKRQVNSRTGEIEFVSPW 27 M+KKQLRQIKK QVNSRTG++E VSPW Sbjct: 87 MNKKQLRQIKKTQVNSRTGQVELVSPW 113
BLAST of mRNA_H-paniculata_contig1240.1513.1 vs. uniprot
Match: A0A836C9I7_9STRA (Coiled-coil domain-containing protein 86 (Fragment) n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836C9I7_9STRA) HSP 1 Score: 48.9 bits (115), Expect = 3.760e-6 Identity = 22/27 (81.48%), Postives = 25/27 (92.59%), Query Frame = 0 Query: 1 MSKKQLRQIKKRQVNSRTGEIEFVSPW 27 MSKKQLRQIKK QVNS+TG++E VSPW Sbjct: 102 MSKKQLRQIKKMQVNSKTGQVELVSPW 128
BLAST of mRNA_H-paniculata_contig1240.1513.1 vs. uniprot
Match: A0A7S2SQR5_9STRA (Coiled-coil domain-containing protein 86 n=1 Tax=Rhizochromulina marina TaxID=1034831 RepID=A0A7S2SQR5_9STRA) HSP 1 Score: 48.9 bits (115), Expect = 8.720e-6 Identity = 22/27 (81.48%), Postives = 25/27 (92.59%), Query Frame = 0 Query: 1 MSKKQLRQIKKRQVNSRTGEIEFVSPW 27 M+KKQLRQIKK QVNSRTG++E VSPW Sbjct: 167 MNKKQLRQIKKTQVNSRTGQVELVSPW 193 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig1240.1513.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 4
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-paniculata_contig1240.1513.1 ID=prot_H-paniculata_contig1240.1513.1|Name=mRNA_H-paniculata_contig1240.1513.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=35bpback to top |