mRNA_H-paniculata_contig11908.1223.1 (mRNA) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig11908.1223.1 vs. uniprot
Match: A0A6H5K5T2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K5T2_9PHAE) HSP 1 Score: 120 bits (300), Expect = 5.720e-28 Identity = 58/63 (92.06%), Postives = 60/63 (95.24%), Query Frame = 2 Query: 2 YITAAMNPRMLMTVDEQLNPLPVNVRVGQAVETIGQAGKPKTITGFQTHTTPVLLGVRDRAEV 190 YITAAMNPRMLMTVD L PLPVNVRVGQAVET+GQAGKPKTITGFQTHTTPVLLGVRDRAE+ Sbjct: 886 YITAAMNPRMLMTVDSDLKPLPVNVRVGQAVETVGQAGKPKTITGFQTHTTPVLLGVRDRAEL 948
BLAST of mRNA_H-paniculata_contig11908.1223.1 vs. uniprot
Match: A0A6A5ADN9_9STRA (RPN1_C domain-containing protein n=2 Tax=Aphanomyces astaci TaxID=112090 RepID=A0A6A5ADN9_9STRA) HSP 1 Score: 100 bits (250), Expect = 2.700e-24 Identity = 48/62 (77.42%), Postives = 55/62 (88.71%), Query Frame = 2 Query: 5 ITAAMNPRMLMTVDEQLNPLPVNVRVGQAVETIGQAGKPKTITGFQTHTTPVLLGVRDRAEV 190 I AM PRML+TVDEQ NPLPV+VRVGQAVE +GQAG+PK+ITGFQTH TPVLL V+DRAE+ Sbjct: 16 IVTAMQPRMLITVDEQGNPLPVSVRVGQAVEVVGQAGRPKSITGFQTHNTPVLLNVKDRAEL 77
BLAST of mRNA_H-paniculata_contig11908.1223.1 vs. uniprot
Match: W7TKW5_9STRA (Armadillo-like helical n=2 Tax=Monodopsidaceae TaxID=425072 RepID=W7TKW5_9STRA) HSP 1 Score: 108 bits (271), Expect = 4.340e-24 Identity = 51/59 (86.44%), Postives = 57/59 (96.61%), Query Frame = 2 Query: 14 AMNPRMLMTVDEQLNPLPVNVRVGQAVETIGQAGKPKTITGFQTHTTPVLLGVRDRAEV 190 AMNPRML+T+DE LNPLPV VRVGQAVET+GQAG+PKTITGFQTHTTPVLLGV+DRAE+ Sbjct: 835 AMNPRMLITLDEDLNPLPVTVRVGQAVETVGQAGRPKTITGFQTHTTPVLLGVKDRAEL 893
BLAST of mRNA_H-paniculata_contig11908.1223.1 vs. uniprot
Match: A0A7S1E2Q6_9STRA (Hypothetical protein n=1 Tax=Thalassionema nitzschioides TaxID=33649 RepID=A0A7S1E2Q6_9STRA) HSP 1 Score: 100 bits (250), Expect = 6.460e-24 Identity = 47/63 (74.60%), Postives = 57/63 (90.48%), Query Frame = 2 Query: 2 YITAAMNPRMLMTVDEQLNPLPVNVRVGQAVETIGQAGKPKTITGFQTHTTPVLLGVRDRAEV 190 Y+T AMNPRML+TV+E+++ PV VRVGQAVET+GQAGKPK ITGFQTH TPVLLGV++RAE+ Sbjct: 44 YLTCAMNPRMLITVNEEISLRPVTVRVGQAVETVGQAGKPKRITGFQTHQTPVLLGVKERAEL 106
BLAST of mRNA_H-paniculata_contig11908.1223.1 vs. uniprot
Match: A0A7S2CWB6_9STRA (Hypothetical protein n=1 Tax=Dictyocha speculum TaxID=35687 RepID=A0A7S2CWB6_9STRA) HSP 1 Score: 105 bits (263), Expect = 5.090e-23 Identity = 47/63 (74.60%), Postives = 57/63 (90.48%), Query Frame = 2 Query: 2 YITAAMNPRMLMTVDEQLNPLPVNVRVGQAVETIGQAGKPKTITGFQTHTTPVLLGVRDRAEV 190 Y+T AMNPRMLMTVDE+ PLP+NVRVG+AVET+GQAGKPK+I+GFQTHTTPVL+ V +R E+ Sbjct: 811 YVTTAMNPRMLMTVDEEFQPLPINVRVGKAVETVGQAGKPKSISGFQTHTTPVLISVTERVEL 873
BLAST of mRNA_H-paniculata_contig11908.1223.1 vs. uniprot
Match: A0A7S0WQH9_9CHLO (26S proteasome non-ATPase regulatory subunit 2 homolog n=1 Tax=Pyramimonas obovata TaxID=1411642 RepID=A0A7S0WQH9_9CHLO) HSP 1 Score: 104 bits (260), Expect = 1.280e-22 Identity = 49/63 (77.78%), Postives = 57/63 (90.48%), Query Frame = 2 Query: 2 YITAAMNPRMLMTVDEQLNPLPVNVRVGQAVETIGQAGKPKTITGFQTHTTPVLLGVRDRAEV 190 Y+ +AM+PRMLMT+DE+ PLPV VRVGQAV+ +GQAGKPKTITGFQTHTTPVLLGV DRAE+ Sbjct: 804 YLVSAMSPRMLMTLDEEGKPLPVTVRVGQAVDVVGQAGKPKTITGFQTHTTPVLLGVGDRAEL 866
BLAST of mRNA_H-paniculata_contig11908.1223.1 vs. uniprot
Match: A0A7S2G4T1_9STRA (Hypothetical protein n=1 Tax=Florenciella parvula TaxID=236787 RepID=A0A7S2G4T1_9STRA) HSP 1 Score: 104 bits (259), Expect = 1.740e-22 Identity = 48/63 (76.19%), Postives = 58/63 (92.06%), Query Frame = 2 Query: 2 YITAAMNPRMLMTVDEQLNPLPVNVRVGQAVETIGQAGKPKTITGFQTHTTPVLLGVRDRAEV 190 Y+T+AMNPRML+TVDE+ PLPV+VRVGQAVET+GQAG+PKTI+GFQTHTTPVLL +RAE+ Sbjct: 797 YVTSAMNPRMLITVDEEFEPLPVSVRVGQAVETVGQAGRPKTISGFQTHTTPVLLTAIERAEL 859
BLAST of mRNA_H-paniculata_contig11908.1223.1 vs. uniprot
Match: A0A0P1AZB9_PLAHL (26s proteasome non-atpase regulatory subunit 2 n=2 Tax=Peronosporaceae TaxID=4777 RepID=A0A0P1AZB9_PLAHL) HSP 1 Score: 104 bits (259), Expect = 1.740e-22 Identity = 49/62 (79.03%), Postives = 57/62 (91.94%), Query Frame = 2 Query: 5 ITAAMNPRMLMTVDEQLNPLPVNVRVGQAVETIGQAGKPKTITGFQTHTTPVLLGVRDRAEV 190 I AM PRML+T+DE+LNPLPV+VRVGQAVE +GQAG+PK+ITGFQTHTTPVLL VRDRAE+ Sbjct: 808 IATAMQPRMLITLDEELNPLPVSVRVGQAVEIVGQAGRPKSITGFQTHTTPVLLNVRDRAEL 869
BLAST of mRNA_H-paniculata_contig11908.1223.1 vs. uniprot
Match: A0A836CK10_9STRA (26S proteasome non-ATPase regulatory subunit 2 n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CK10_9STRA) HSP 1 Score: 104 bits (259), Expect = 1.750e-22 Identity = 49/63 (77.78%), Postives = 55/63 (87.30%), Query Frame = 2 Query: 2 YITAAMNPRMLMTVDEQLNPLPVNVRVGQAVETIGQAGKPKTITGFQTHTTPVLLGVRDRAEV 190 ++ AM PRMLM VDE + PL V VRVGQAVET+GQAG+PKTITGFQTHTTPVLLGVRDRAE+ Sbjct: 834 FLACAMQPRMLMAVDEDVKPLSVTVRVGQAVETVGQAGRPKTITGFQTHTTPVLLGVRDRAEL 896
BLAST of mRNA_H-paniculata_contig11908.1223.1 vs. uniprot
Match: UPI000C25414F (26S proteasome non-ATPase regulatory subunit 2-like n=1 Tax=Leptinotarsa decemlineata TaxID=7539 RepID=UPI000C25414F) HSP 1 Score: 95.9 bits (237), Expect = 2.220e-22 Identity = 45/62 (72.58%), Postives = 53/62 (85.48%), Query Frame = 2 Query: 5 ITAAMNPRMLMTVDEQLNPLPVNVRVGQAVETIGQAGKPKTITGFQTHTTPVLLGVRDRAEV 190 + AAM PRML+T DE+LNPLP+ VRVG AV+ +GQAGKPKTITGFQTHTTPVLL +RAE+ Sbjct: 15 LAAAMQPRMLVTFDEELNPLPIPVRVGLAVDVVGQAGKPKTITGFQTHTTPVLLAYGERAEL 76 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig11908.1223.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-paniculata_contig11908.1223.1 >prot_H-paniculata_contig11908.1223.1 ID=prot_H-paniculata_contig11908.1223.1|Name=mRNA_H-paniculata_contig11908.1223.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=70bp MNPRMLMTVDEQLNPLPVNVRVGQAVETIGQAGKPKTITGFQTHTTPVLLback to top mRNA from alignment at H-paniculata_contig11908:4845..5947+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-paniculata_contig11908.1223.1 ID=mRNA_H-paniculata_contig11908.1223.1|Name=mRNA_H-paniculata_contig11908.1223.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=mRNA|length=1103bp|location=Sequence derived from alignment at H-paniculata_contig11908:4845..5947+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top Coding sequence (CDS) from alignment at H-paniculata_contig11908:4845..5947+ >mRNA_H-paniculata_contig11908.1223.1 ID=mRNA_H-paniculata_contig11908.1223.1|Name=mRNA_H-paniculata_contig11908.1223.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=CDS|length=420bp|location=Sequence derived from alignment at H-paniculata_contig11908:4845..5947+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top |