mRNA_H-paniculata_contig11859.1192.1 (mRNA) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig11859.1192.1 vs. uniprot
Match: A0A6H5JCW3_9PHAE (Uncharacterized protein n=2 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JCW3_9PHAE) HSP 1 Score: 86.3 bits (212), Expect = 4.740e-18 Identity = 41/72 (56.94%), Postives = 54/72 (75.00%), Query Frame = 1 Query: 4 IGFLAILVWNGIIDVVEVNFMMVGHTQFKFDQIFSRLAVGVRGKNIFTRSQQSEILKDSYKHLPVHCTALRN 219 +GF +LV +I VVE+NFMMVGHT K DQIFSR + G++GKNIFTR+Q +E+L+ SY +PV C+ L N Sbjct: 34 LGFAGLLVAASVIRVVEINFMMVGHTHMKIDQIFSRFSRGIKGKNIFTRTQLAEVLQASYTEVPVFCSTLGN 105
BLAST of mRNA_H-paniculata_contig11859.1192.1 vs. uniprot
Match: A0A6H5JUU1_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JUU1_9PHAE) HSP 1 Score: 80.1 bits (196), Expect = 7.070e-16 Identity = 37/72 (51.39%), Postives = 53/72 (73.61%), Query Frame = 1 Query: 4 IGFLAILVWNGIIDVVEVNFMMVGHTQFKFDQIFSRLAVGVRGKNIFTRSQQSEILKDSYKHLPVHCTALRN 219 +G+ +LV ++ VVE++FMMVGHT K DQ+FSR + G++GKNIFTR+ +E L+ SY +PV C+ LRN Sbjct: 237 LGYAGLLVAADVVRVVEIHFMMVGHTHTKIDQVFSRFSRGIKGKNIFTRTHLAEELRASYTEVPVFCSTLRN 308 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig11859.1192.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-paniculata_contig11859.1192.1 >prot_H-paniculata_contig11859.1192.1 ID=prot_H-paniculata_contig11859.1192.1|Name=mRNA_H-paniculata_contig11859.1192.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=73bp MIGFLAILVWNGIIDVVEVNFMMVGHTQFKFDQIFSRLAVGVRGKNIFTRback to top mRNA from alignment at H-paniculata_contig11859:4324..5063+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-paniculata_contig11859.1192.1 ID=mRNA_H-paniculata_contig11859.1192.1|Name=mRNA_H-paniculata_contig11859.1192.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=mRNA|length=740bp|location=Sequence derived from alignment at H-paniculata_contig11859:4324..5063+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top Coding sequence (CDS) from alignment at H-paniculata_contig11859:4324..5063+ >mRNA_H-paniculata_contig11859.1192.1 ID=mRNA_H-paniculata_contig11859.1192.1|Name=mRNA_H-paniculata_contig11859.1192.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=CDS|length=438bp|location=Sequence derived from alignment at H-paniculata_contig11859:4324..5063+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top |