prot_H-paniculata_contig1175.1118.1 (polypeptide) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig1175.1118.1 vs. uniprot
Match: D8LH28_ECTSI (UDENN domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LH28_ECTSI) HSP 1 Score: 82.4 bits (202), Expect = 2.070e-14 Identity = 50/85 (58.82%), Postives = 57/85 (67.06%), Query Frame = 0 Query: 8 GPGAGDG----GVDV--------DAAVTVGKALLEVQRQVLRKLCATVYPEFQASPSYEHLCEELTTGARSSARARQPASPPYSL 80 GPGAGD G D D AV+VGKALL++QR VLRK+CA+VYP+FQAS S+EHLC ELTTG RS AR P PP L Sbjct: 59 GPGAGDASSGDGPDTQKGRDAGDDYAVSVGKALLDMQRHVLRKICASVYPDFQASSSHEHLCAELTTGTRSPARL--PPGPPDQL 141
BLAST of mRNA_H-paniculata_contig1175.1118.1 vs. uniprot
Match: A0A6H5JHW4_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JHW4_9PHAE) HSP 1 Score: 55.5 bits (132), Expect = 2.980e-5 Identity = 28/42 (66.67%), Postives = 31/42 (73.81%), Query Frame = 0 Query: 39 LCATVYPEFQASPSYEHLCEELTTGARSSARARQPASPPYSL 80 LCA+VYP+FQAS S+EHLC ELTTG RS AR P PP L Sbjct: 869 LCASVYPDFQASSSHEHLCAELTTGTRSPARL--PPGPPDEL 908 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig1175.1118.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-paniculata_contig1175.1118.1 ID=prot_H-paniculata_contig1175.1118.1|Name=mRNA_H-paniculata_contig1175.1118.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=230bpback to top |