mRNA_H-paniculata_contig11563.1000.1 (mRNA) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig11563.1000.1 vs. uniprot
Match: A0A834XC68_9FABA (Retrovirus-related Pol polyprotein from transposon TNT 1-94 n=1 Tax=Senna tora TaxID=362788 RepID=A0A834XC68_9FABA) HSP 1 Score: 55.8 bits (133), Expect = 2.730e-7 Identity = 28/74 (37.84%), Postives = 39/74 (52.70%), Query Frame = 1 Query: 7 WNSDTGAIDHMTSDETAFEDYTPAFPWIMCEIANGNFVLMAGWGRLVLLVTAKLGRVAHVPELGCNLISTRRAT 228 W D+GA DHMTS+++ F P + +IA G + G G + + T L V HVP L CNL+S + T Sbjct: 95 WIVDSGASDHMTSNDSLFSTLAPCKTSLQVKIAYGTMAKVLGIGSVKISDTITLLNVLHVPTLACNLLSISKLT 168 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig11563.1000.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-paniculata_contig11563.1000.1 >prot_H-paniculata_contig11563.1000.1 ID=prot_H-paniculata_contig11563.1000.1|Name=mRNA_H-paniculata_contig11563.1000.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=76bp EHWNSDTGAIDHMTSDETAFEDYTPAFPWIMCEIANGNFVLMAGWGRLVLback to top mRNA from alignment at H-paniculata_contig11563:932..1183- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-paniculata_contig11563.1000.1 ID=mRNA_H-paniculata_contig11563.1000.1|Name=mRNA_H-paniculata_contig11563.1000.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=mRNA|length=252bp|location=Sequence derived from alignment at H-paniculata_contig11563:932..1183- (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top Coding sequence (CDS) from alignment at H-paniculata_contig11563:932..1183- >mRNA_H-paniculata_contig11563.1000.1 ID=mRNA_H-paniculata_contig11563.1000.1|Name=mRNA_H-paniculata_contig11563.1000.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=CDS|length=456bp|location=Sequence derived from alignment at H-paniculata_contig11563:932..1183- (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top |