prot_H-paniculata_contig11500.969.1 (polypeptide) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig11500.969.1 vs. uniprot
Match: D8LJ31_ECTSI (MFS domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LJ31_ECTSI) HSP 1 Score: 99.8 bits (247), Expect = 4.050e-26 Identity = 43/66 (65.15%), Postives = 58/66 (87.88%), Query Frame = 0 Query: 1 MDLRWQGWVSSLYGIMSFFIAPVLARASDSLGRVSMLQVSAIGSLAGALGSLYATEKWSFIAARLV 66 MDLRWQGWV+S YG++SFF+ P+L R SDS+GRV+ML++S +G++ GALGSLYAT +W+FIA+R V Sbjct: 10 MDLRWQGWVASTYGLISFFVGPMLGRVSDSMGRVAMLKMSCVGNIIGALGSLYATGRWTFIASRKV 75
BLAST of mRNA_H-paniculata_contig11500.969.1 vs. uniprot
Match: A0A6H5JC31_9PHAE (MFS domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JC31_9PHAE) HSP 1 Score: 99.8 bits (247), Expect = 6.600e-23 Identity = 43/64 (67.19%), Postives = 57/64 (89.06%), Query Frame = 0 Query: 1 MDLRWQGWVSSLYGIMSFFIAPVLARASDSLGRVSMLQVSAIGSLAGALGSLYATEKWSFIAAR 64 MDLRWQGWV+S YGI+SFF+ P+L R SDS+GRV+ML++S +G++ GALGSLYAT +W+FIA+R Sbjct: 94 MDLRWQGWVASTYGIISFFVGPMLGRVSDSMGRVAMLKMSCVGNMIGALGSLYATGRWTFIASR 157
BLAST of mRNA_H-paniculata_contig11500.969.1 vs. uniprot
Match: A0A835Z3Q7_9STRA (Major facilitator superfamily domain-containing protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835Z3Q7_9STRA) HSP 1 Score: 70.9 bits (172), Expect = 9.210e-13 Identity = 34/66 (51.52%), Postives = 49/66 (74.24%), Query Frame = 0 Query: 1 MDLRWQGWVSSLYGIMSFFIAPVLARASDSLGRVSMLQVSAIGSLAGALGSLYATEKWSFIAARLV 66 MDL QG+V S + +F ++P+L RASDS GRV++L++SA GS+ GA G+L A KW+FI AR++ Sbjct: 66 MDLVQQGYVGSASALSAFVMSPILGRASDSYGRVTLLKLSAAGSILGAAGTLLAPNKWAFILARVL 131 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig11500.969.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 3
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-paniculata_contig11500.969.1 ID=prot_H-paniculata_contig11500.969.1|Name=mRNA_H-paniculata_contig11500.969.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=66bpback to top |