mRNA_H-paniculata_contig11324.852.1 (mRNA) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig11324.852.1 vs. uniprot
Match: D7G1H8_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G1H8_ECTSI) HSP 1 Score: 73.6 bits (179), Expect = 7.580e-14 Identity = 31/48 (64.58%), Postives = 38/48 (79.17%), Query Frame = 1 Query: 1 QVCMKSGVAFGLTSSRYHCVSCGNAFVQEFCSKRVPLPHHGLEEVTLV 144 +VCMKSGVAFG+T SR++C SCG FV E C++RVPLPHHG E+ V Sbjct: 140 EVCMKSGVAFGMTQSRHYCSSCGRVFVVEHCNQRVPLPHHGFEQAVRV 187
BLAST of mRNA_H-paniculata_contig11324.852.1 vs. uniprot
Match: A0A6H5KWD1_9PHAE (PI3K/PI4K catalytic domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KWD1_9PHAE) HSP 1 Score: 68.9 bits (167), Expect = 3.220e-12 Identity = 29/43 (67.44%), Postives = 35/43 (81.40%), Query Frame = 1 Query: 4 VCMKSGVAFGLTSSRYHCVSCGNAFVQEFCSKRVPLPHHGLEE 132 VCMKSGVAFG+T SR++C SCG FV E C++RVPLP HG E+ Sbjct: 185 VCMKSGVAFGMTQSRHYCSSCGRVFVLEHCNQRVPLPQHGFEQ 227
BLAST of mRNA_H-paniculata_contig11324.852.1 vs. uniprot
Match: A0A835YUK5_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YUK5_9STRA) HSP 1 Score: 57.8 bits (138), Expect = 2.780e-8 Identity = 29/46 (63.04%), Postives = 30/46 (65.22%), Query Frame = 1 Query: 7 CMKSGV-----AFGLTSSRYHCVSCGNAFVQEFCSKRVPLPHHGLE 129 C KSGV AFGLT SRY+CVSCG AF E C PL HHGLE Sbjct: 304 CAKSGVGLDNLAFGLTQSRYNCVSCGRAFTFEHCHLECPLVHHGLE 349 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig11324.852.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-paniculata_contig11324.852.1 >prot_H-paniculata_contig11324.852.1 ID=prot_H-paniculata_contig11324.852.1|Name=mRNA_H-paniculata_contig11324.852.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=55bp MKSGVAFGLTSSRYHCVSCGNAFVQEFCSKRVPLPHHGLEEVTLVHMKTSback to top mRNA from alignment at H-paniculata_contig11324:608..781+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-paniculata_contig11324.852.1 ID=mRNA_H-paniculata_contig11324.852.1|Name=mRNA_H-paniculata_contig11324.852.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=mRNA|length=174bp|location=Sequence derived from alignment at H-paniculata_contig11324:608..781+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top Coding sequence (CDS) from alignment at H-paniculata_contig11324:608..781+ >mRNA_H-paniculata_contig11324.852.1 ID=mRNA_H-paniculata_contig11324.852.1|Name=mRNA_H-paniculata_contig11324.852.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=CDS|length=330bp|location=Sequence derived from alignment at H-paniculata_contig11324:608..781+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top |