prot_H-paniculata_contig11307.840.1 (polypeptide) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig11307.840.1 vs. uniprot
Match: A0A6H5KK33_9PHAE (C2 domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KK33_9PHAE) HSP 1 Score: 72.8 bits (177), Expect = 3.470e-13 Identity = 30/52 (57.69%), Postives = 40/52 (76.92%), Query Frame = 0 Query: 10 TRVLLLPTDFEAVCRIYSVALAAVTEGIPWIRAVDVWHISSVAEHETVFLPE 61 T +L P +EAVC IYS A+ A+TEG+PW+RA DVWH+SS+ +H+ VF PE Sbjct: 2572 TSILRWPCPYEAVCNIYSAAVKALTEGLPWVRAADVWHVSSIPDHKKVFEPE 2623
BLAST of mRNA_H-paniculata_contig11307.840.1 vs. uniprot
Match: D8LEV4_ECTSI (C2 domain containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LEV4_ECTSI) HSP 1 Score: 67.8 bits (164), Expect = 2.020e-11 Identity = 27/42 (64.29%), Postives = 36/42 (85.71%), Query Frame = 0 Query: 20 EAVCRIYSVALAAVTEGIPWIRAVDVWHISSVAEHETVFLPE 61 EAVC+IYS A+ A+TEG+PW+RA DVWH+SS+ +H+ VF PE Sbjct: 5290 EAVCKIYSAAVKALTEGLPWVRAADVWHVSSIPDHKKVFEPE 5331 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig11307.840.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-paniculata_contig11307.840.1 ID=prot_H-paniculata_contig11307.840.1|Name=mRNA_H-paniculata_contig11307.840.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=79bpback to top |