prot_H-paniculata_contig11275.815.1 (polypeptide) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig11275.815.1 vs. uniprot
Match: A0A6A4G9J9_9STRA (Reverse transcriptase domain-containing protein n=2 Tax=Phytophthora rubi TaxID=129364 RepID=A0A6A4G9J9_9STRA) HSP 1 Score: 58.9 bits (141), Expect = 1.030e-7 Identity = 36/118 (30.51%), Postives = 60/118 (50.85%), Query Frame = 0 Query: 1 ALKLAIEEARAEGLPPNRVTELRELVINPYFEAFRRTLGRDPPTDMKPLWVHVPVDARTSRARPRPMSRDKAKWPYDHFTKLAQAGMVITNHQARFNSVAMILPK---KDTYRMLVDY 115 +L I++A A G PPN ++ LR V++ Y + +R G D P ++P V + D R +PR ++ + H +L Q G+V N+ +R+ A+ K KD +R+ DY Sbjct: 547 SLGALIQDAEANGFPPNMMSSLRTTVLD-YGDVWRARFGADGPARVRPYSVKLKPDVLPFRCKPRRYPPLQSDFLRSHVAELQQFGLVRLNNASRWACAAVPARKAGLKDAFRLTTDY 663
BLAST of mRNA_H-paniculata_contig11275.815.1 vs. uniprot
Match: A0A225UJN6_9STRA (Peptidase A2 domain-containing protein n=1 Tax=Phytophthora megakarya TaxID=4795 RepID=A0A225UJN6_9STRA) HSP 1 Score: 55.8 bits (133), Expect = 1.110e-6 Identity = 33/115 (28.70%), Postives = 62/115 (53.91%), Query Frame = 0 Query: 6 IEEARAEGLPPNRVTELRELVINPYFEAFRRTLGRDPPTDMKPLWVHVPVDARTSRARPRPMSRDKAKWPYDHFTKLAQAGMVITNHQARFNSVAMILPK---KDTYRMLVDYHA 117 ++ A GLPP V +REL + + + +R T+G DPP ++ L V + + A R+ PR + +A++ D+ L G+V N+ +R+ + + K +D +R+ +DY + Sbjct: 131 LDRAATNGLPPEHVDAVREL-LEEFPDVWRETVGADPPATVERLQVTLQLGAVPHRSPPRKYAPMQAQFIRDYVKFLVDNGLVEQNNASRWACAVVPVRKHGTQDRFRLTIDYRS 244 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig11275.815.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-paniculata_contig11275.815.1 ID=prot_H-paniculata_contig11275.815.1|Name=mRNA_H-paniculata_contig11275.815.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=117bpback to top |