prot_H-paniculata_contig10808.520.1 (polypeptide) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig10808.520.1 vs. uniprot
Match: D7FW92_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FW92_ECTSI) HSP 1 Score: 68.6 bits (166), Expect = 7.940e-10 Identity = 44/94 (46.81%), Postives = 56/94 (59.57%), Query Frame = 0 Query: 76 VPEMFQADVIALADVALVTGKISKQDYIQALYKAVTLDPTLVEMYRADVRQLLRGTSGAGDESPWATLGALGA--------SFEPRRQPPAPVA 161 VPE FQ D +ALADVALVTGKISKQ Y++AL+K VTLD +LV Y + +Q G G+ A + A G + +PR+QP A A Sbjct: 258 VPESFQVDALALADVALVTGKISKQAYVRALHKVVTLDSSLVSAYLGERKQ---GRQEDGEGMLEAVVRAFGPEQQGRTADNDDPRQQPRAAAA 348 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig10808.520.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-paniculata_contig10808.520.1 ID=prot_H-paniculata_contig10808.520.1|Name=mRNA_H-paniculata_contig10808.520.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=220bpback to top |