Gvermi3559.t1 (polypeptide) Gracilaria vermiculophylla HapMaleFtJ_2017 male

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview


Name	Gvermi3559.t1
Unique Name	Gvermi3559.t1
Type	polypeptide
Organism	Gracilaria vermiculophylla HapMaleFtJ_2017 male (Gracilaria vermiculophylla HapMaleFtJ_2017 male)
Sequence length	473

Homology

The following BLAST results are available for this feature:

BLAST of Gvermi3559.t1 vs. uniprot

BLAST of Gvermi3559.t1 vs. uniprot
Analysis Date: 2022-06-02 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 0


Match Name	E-value	Identity	Description

InterPro

Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-06-01


IPR Term	IPR Description	Source	Source Term	Source Description	Alignment
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 389..406
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 389..429
None	No IPR available	PHOBIUS	TRANSMEMBRANE	Transmembrane region	coord: 7..25
None	No IPR available	PHOBIUS	TRANSMEMBRANE	Transmembrane region	coord: 173..192
None	No IPR available	PHOBIUS	CYTOPLASMIC_DOMAIN	Cytoplasmic domain	coord: 1..6
None	No IPR available	PHOBIUS	CYTOPLASMIC_DOMAIN	Cytoplasmic domain	coord: 64..83
None	No IPR available	PHOBIUS	CYTOPLASMIC_DOMAIN	Cytoplasmic domain	coord: 193..472
None	No IPR available	PHOBIUS	TRANSMEMBRANE	Transmembrane region	coord: 45..63
None	No IPR available	PHOBIUS	TRANSMEMBRANE	Transmembrane region	coord: 84..106
None	No IPR available	PHOBIUS	TRANSMEMBRANE	Transmembrane region	coord: 112..129
None	No IPR available	PHOBIUS	NON_CYTOPLASMIC_DOMAIN	Non cytoplasmic domain	coord: 26..44
None	No IPR available	PHOBIUS	TRANSMEMBRANE	Transmembrane region	coord: 136..153
None	No IPR available	PHOBIUS	CYTOPLASMIC_DOMAIN	Cytoplasmic domain	coord: 130..135
None	No IPR available	PHOBIUS	NON_CYTOPLASMIC_DOMAIN	Non cytoplasmic domain	coord: 154..172
None	No IPR available	PHOBIUS	NON_CYTOPLASMIC_DOMAIN	Non cytoplasmic domain	coord: 107..111
None	No IPR available	TMHMM	TMhelix		coord: 84..106
None	No IPR available	TMHMM	TMhelix		coord: 111..128
None	No IPR available	TMHMM	TMhelix		coord: 7..29
None	No IPR available	TMHMM	TMhelix		coord: 135..152
None	No IPR available	TMHMM	TMhelix		coord: 49..71

Alignments

The following features are aligned


Aligned Feature	Feature Type	Alignment Location
ScGOVlb_41	contig	ScGOVlb_41:3347259..3348677 -

Analyses

This polypeptide is derived from or has results from the following analyses


Analysis Name	Date Performed
InterProScan on OGS1.0	2022-06-01
Diamond blastp: OGS1.0 vs UniRef90	2022-06-02
Gracilaria vermiculophylla HapMaleFtJ_2017 male OGS1.0	2022-05-09

Relationships

This polypeptide derives from the following mRNA feature(s):


Feature Name	Unique Name	Species	Type	Position
Gvermi3559.t1	Gvermi3559.t1	Gracilaria vermiculophylla HapMaleFtJ_2017 male	mRNA	ScGOVlb_41 3347259..3348677 -

Sequences

The following sequences are available for this feature:

polypeptide sequence

polypeptide sequence

>Gvermi3559.t1 ID=Gvermi3559.t1|Name=Gvermi3559.t1|organism=Gracilaria vermiculophylla HapMaleFtJ_2017 male|type=polypeptide|length=473bp
MRHVARLFGLMLPALIVVGAVPYSGEHITRNTIESEAEGKSIISAQGPGF
LVLAGVALCILAIDIIDLLSYRHRHNTCFPRVKIILRMIVFFILIGACLW
AMVLAFEKPSQYTYGLYLAALITAVSIGSRGFSSSSSFRLIILLVWSLMS
FSKEEKDLLRFALDKLIPLAVDSNLWTMLAFPEYLNMVSFWLRIGDRQLL
DTLFSESSWSKIMKLHQLQERETDFQRLHHSGNQSVSYAVRKLANYDIGQ
DSPSSLPFRIRVDLAIYCMDLEDDQLLMKICGPDFGQEVACATMLSQLQQ
RLPGPNAFSTTGRGYLRAALKDLLALASDENNHSIPYPVQVELVFLYLRE
VERSNRNDDTIIEQEQNLTVHDREEKDWIRKWVHRFHNPHSSDGSNAGSE
SSSPADVMKNEAEVPESTDIPGSTTETREEQAIRLVAQIYGRIRRAGTYA
DPQHLRTYRQFIPEEGQYVSAK*