Ggra9848.t1 (polypeptide) Gracilaria gracilis GNS1m male
Overview
Homology
BLAST of Ggra9848.t1 vs. uniprot
Match: A0A2V3IIJ3 (Uncharacterized protein n=1 Tax=Gracilariopsis chorda TaxID=448386 RepID=A0A2V3IIJ3_9FLOR) HSP 1 Score: 71.6 bits (174), Expect = 6.150e-13 Identity = 43/124 (34.68%), Postives = 66/124 (53.23%), Query Frame = 0 Query: 4 SLASKDHLFYMQSLTNEQLLAVSQSAPAPIRKNLTSSATQQELLAKVFRIRELEIAAKHPVIGSNAATSLKTLIHMSASDILKASQEQPQNLLQLMTDALSADPSLLPRNIRANNPSEAAAIAI 127 SL SK+ ++Y+ +L +QL + QSAP +R + T+ +LLA +FR+R+ E A L+ L+ S + K + + P L ++M AL AD +L PR I NP EA +AI Sbjct: 22 SLMSKEPIYYLTTLNEQQLQMIVQSAPPHLRTTFSDPPTKPQLLADLFRLRQAEAAMSSD--PQAVMQDLEKLLSTSQDGLRKMTNDDPNELKRMMNSALKADATLSPREI-PENPLEAGMVAI 142 The following BLAST results are available for this feature:
BLAST of Ggra9848.t1 vs. uniprot
Analysis Date: 2022-06-02 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Ggra9848.t1 ID=Ggra9848.t1|Name=Ggra9848.t1|organism=Gracilaria gracilis GNS1m male|type=polypeptide|length=129bpback to top |