Ggra10130.t1 (polypeptide) Gracilaria gracilis GNS1m male
Overview
Homology
BLAST of Ggra10130.t1 vs. uniprot
Match: A0A2V3IC09 (Uncharacterized protein n=2 Tax=Gracilariopsis chorda TaxID=448386 RepID=A0A2V3IC09_9FLOR) HSP 1 Score: 60.8 bits (146), Expect = 6.820e-7 Identity = 31/73 (42.47%), Postives = 46/73 (63.01%), Query Frame = 0 Query: 5 GENSKNAVSFLNSKISDKSRNQYMSGADRLLKAEVVDKLCFLETNKTVLLRIRSLSGVRLWSVQKIQETVQTW 77 G NS++A+ FL+ + S YMSGAD+LL A+V+ LC+LE + + SL+ VR WS+ +IQ+T W Sbjct: 192 GINSRHAIQFLDFTLKPNSIRGYMSGADKLLHADVLPDLCYLEKHARTRFSLASLNTVRNWSLHRIQKTFTYW 264
BLAST of Ggra10130.t1 vs. uniprot
Match: A0A2V3IEG8 (Uncharacterized protein n=1 Tax=Gracilariopsis chorda TaxID=448386 RepID=A0A2V3IEG8_9FLOR) HSP 1 Score: 58.5 bits (140), Expect = 4.690e-6 Identity = 31/73 (42.47%), Postives = 46/73 (63.01%), Query Frame = 0 Query: 5 GENSKNAVSFLNSKISDKSRNQYMSGADRLLKAEVVDKLCFLETNKTVLLRIRSLSGVRLWSVQKIQETVQTW 77 G NS++A+ FL+ + S + YMSGAD+LL A+V+ LC+L + SL+ VR WS+ +IQ+TV W Sbjct: 98 GINSRHAIQFLDFNLKPNSIHGYMSGADKLLHADVLPDLCYLGKHVRTRFSRASLNTVRNWSLHRIQKTVTYW 170
BLAST of Ggra10130.t1 vs. uniprot
Match: A0A2V3IQA7 (Uncharacterized protein n=1 Tax=Gracilariopsis chorda TaxID=448386 RepID=A0A2V3IQA7_9FLOR) HSP 1 Score: 57.0 bits (136), Expect = 8.030e-6 Identity = 29/73 (39.73%), Postives = 46/73 (63.01%), Query Frame = 0 Query: 5 GENSKNAVSFLNSKISDKSRNQYMSGADRLLKAEVVDKLCFLETNKTVLLRIRSLSGVRLWSVQKIQETVQTW 77 G NS++A+ L+ + S ++YMSGA++LL+A+V+ LC+LE SL+ VR W + +IQ+TV W Sbjct: 192 GINSRHAIQLLDFTLKPNSISEYMSGANKLLQADVLPHLCYLEKQARTRFSRASLNTVRHWCLHRIQKTVTYW 264 The following BLAST results are available for this feature:
BLAST of Ggra10130.t1 vs. uniprot
Analysis Date: 2022-06-02 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Ggra10130.t1 ID=Ggra10130.t1|Name=Ggra10130.t1|organism=Gracilaria gracilis GNS1m male|type=polypeptide|length=273bpback to top |