Gcaud207.t1 (mRNA) Gracilaria caudata M_176_S67 male
|
Overview
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
The following stop_codon feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
mRNA sequence >Gcaud207.t1 ID=Gcaud207.t1|Name=Gcaud207.t1|organism=Gracilaria caudata M_176_S67 male|type=mRNA|length=98bpback to top spliced messenger RNA >Gcaud207.t1 ID=Gcaud207.t1|Name=Gcaud207.t1|organism=Gracilaria caudata M_176_S67 male|type=mRNA|length=294bp|location=Sequence derived from alignment at NODE_16293_length_329_cov_6.096639:2..295+ (Gracilaria caudata M_176_S67 male)|Notes=Excludes all bases but those of type(s): exon. AACGACTATTGGGAGTATTTCGCCCCAGATCACAAACTCCACTTTTCGGCback to top protein sequence of Gcaud207.t1 >Gcaud207.t1 ID=Gcaud207.t1|Name=Gcaud207.t1|organism=Gracilaria caudata M_176_S67 male|type=polypeptide|length=98bp NDYWEYFAPDHKLHFSADKTVKNLNTPNYIGKVTEKIMENLRCLDAAPSVback to top mRNA from alignment at NODE_16293_length_329_cov_6.096639:2..295+ Legend: CDSpolypeptideexonstop_codon Hold the cursor over a type above to highlight its positions in the sequence below.>Gcaud207.t1 ID=Gcaud207.t1|Name=Gcaud207.t1|organism=Gracilaria caudata M_176_S67 male|type=mRNA|length=294bp|location=Sequence derived from alignment at NODE_16293_length_329_cov_6.096639:2..295+ (Gracilaria caudata M_176_S67 male)back to top Coding sequence (CDS) from alignment at NODE_16293_length_329_cov_6.096639:2..295+ >Gcaud207.t1 ID=Gcaud207.t1|Name=Gcaud207.t1|organism=Gracilaria caudata M_176_S67 male|type=CDS|length=294bp|location=Sequence derived from alignment at NODE_16293_length_329_cov_6.096639:2..295+ (Gracilaria caudata M_176_S67 male)back to top |