Gcaud2386.t1 (mRNA) Gracilaria caudata M_176_S67 male
|
Overview
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Relationships
This mRNA is a part of the following gene feature(s):
The following start_codon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
The following stop_codon feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
mRNA sequence >Gcaud2386.t1 ID=Gcaud2386.t1|Name=Gcaud2386.t1|organism=Gracilaria caudata M_176_S67 male|type=mRNA|length=131bpback to top spliced messenger RNA >Gcaud2386.t1 ID=Gcaud2386.t1|Name=Gcaud2386.t1|organism=Gracilaria caudata M_176_S67 male|type=mRNA|length=393bp|location=Sequence derived from alignment at NODE_830_length_17382_cov_5.634087:8405..8797+ (Gracilaria caudata M_176_S67 male)|Notes=Excludes all bases but those of type(s): exon. ATGCAGCCCGAGATCGCGTCTACGTCGCCGTCCGCAGAGAAGCCCGTCACback to top protein sequence of Gcaud2386.t1 >Gcaud2386.t1 ID=Gcaud2386.t1|Name=Gcaud2386.t1|organism=Gracilaria caudata M_176_S67 male|type=polypeptide|length=131bp MQPEIASTSPSAEKPVTPVVPSTKGHRPWKKHKRRPASAQRRTAALKLTLback to top mRNA from alignment at NODE_830_length_17382_cov_5.634087:8405..8797+ Legend: start_codonpolypeptideCDSexonstop_codon Hold the cursor over a type above to highlight its positions in the sequence below.>Gcaud2386.t1 ID=Gcaud2386.t1|Name=Gcaud2386.t1|organism=Gracilaria caudata M_176_S67 male|type=mRNA|length=393bp|location=Sequence derived from alignment at NODE_830_length_17382_cov_5.634087:8405..8797+ (Gracilaria caudata M_176_S67 male)back to top Coding sequence (CDS) from alignment at NODE_830_length_17382_cov_5.634087:8405..8797+ >Gcaud2386.t1 ID=Gcaud2386.t1|Name=Gcaud2386.t1|organism=Gracilaria caudata M_176_S67 male|type=CDS|length=393bp|location=Sequence derived from alignment at NODE_830_length_17382_cov_5.634087:8405..8797+ (Gracilaria caudata M_176_S67 male)back to top |