|
|
Homology
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-06-01
| IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
|---|
| IPR006597 | Sel1-like repeat | SMART | SM00671 | sel1 | coord: 429..465
e-value: 0.14
score: 21.2
coord: 94..130
e-value: 1.8E-4
score: 30.8
coord: 315..351
e-value: 4.5E-5
score: 32.8
coord: 19..55
e-value: 8.4E-6
score: 35.3
coord: 170..206
e-value: 7.0E-5
score: 32.2
coord: 56..92
e-value: 1.1E-5
score: 34.9
coord: 284..313
e-value: 12.0
score: 13.1
coord: 391..427
e-value: 5.1E-7
score: 39.3
coord: 353..389
e-value: 5.3E-5
score: 32.6
coord: 246..282
e-value: 3.7E-6
score: 36.5
coord: 132..168
e-value: 2.4E-4
score: 30.4
coord: 208..244
e-value: 0.041
score: 23.0 |
| IPR006597 | Sel1-like repeat | PFAM | PF08238 | Sel1 | coord: 170..203
e-value: 1.9E-5
score: 25.2
coord: 56..89
e-value: 7.0E-7
score: 29.8
coord: 287..313
e-value: 0.0021
score: 18.7
coord: 211..243
e-value: 7.2E-4
score: 20.2
coord: 392..427
e-value: 2.7E-8
score: 34.2
coord: 430..462
e-value: 9.0E-5
score: 23.0
coord: 247..281
e-value: 7.1E-8
score: 32.9
coord: 354..389
e-value: 1.4E-5
score: 25.6
coord: 96..127
e-value: 0.014
score: 16.1
coord: 20..54
e-value: 2.5E-4
score: 21.6
coord: 316..348
e-value: 0.0016
score: 19.1
coord: 134..168
e-value: 2.1E-6
score: 28.2 |
| IPR003107 | HAT (Half-A-TPR) repeat | SMART | SM00386 | hat_new_1 | coord: 38..69
e-value: 540.0
score: 2.7
coord: 372..404
e-value: 58.0
score: 9.8
coord: 227..259
e-value: 520.0
score: 2.8
coord: 189..220
e-value: 190.0
score: 6.0
coord: 334..366
e-value: 190.0
score: 6.1
coord: 410..441
e-value: 82.0
score: 8.7 |
| IPR011990 | Tetratricopeptide-like helical domain superfamily | GENE3D | 1.25.40.10 | Tetratricopeptide repeat domain | coord: 208..289
e-value: 4.5E-18
score: 67.8 |
| IPR011990 | Tetratricopeptide-like helical domain superfamily | GENE3D | 1.25.40.10 | Tetratricopeptide repeat domain | coord: 2..207
e-value: 5.1E-51
score: 175.3
coord: 290..473
e-value: 7.6E-43
score: 148.5 |
| None | No IPR available | PANTHER | PTHR43628:SF9 | SEL1-REPEAT-CONTAINING PROTEIN YBEQ | coord: 4..172
coord: 227..351 |
| None | No IPR available | PANTHER | PTHR43628:SF9 | SEL1-REPEAT-CONTAINING PROTEIN YBEQ | coord: 351..467 |
| None | No IPR available | PANTHER | PTHR43628:SF9 | SEL1-REPEAT-CONTAINING PROTEIN YBEQ | coord: 158..291 |
| None | No IPR available | PANTHER | PTHR43628 | ACTIVATOR OF C KINASE PROTEIN 1-RELATED | coord: 351..467 |
| None | No IPR available | PANTHER | PTHR43628 | ACTIVATOR OF C KINASE PROTEIN 1-RELATED | coord: 158..291 |
| None | No IPR available | PANTHER | PTHR43628 | ACTIVATOR OF C KINASE PROTEIN 1-RELATED | coord: 4..172
coord: 227..351 |
| None | No IPR available | SUPERFAMILY | 81901 | HCP-like | coord: 7..132 |
| None | No IPR available | SUPERFAMILY | 81901 | HCP-like | coord: 227..466 |
| None | No IPR available | SUPERFAMILY | 81901 | HCP-like | coord: 95..206 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Gcaud2453.t1 ID=Gcaud2453.t1|Name=Gcaud2453.t1|organism=Gracilaria caudata M_176_S67 male|type=polypeptide|length=483bp
XVRRTKDLYERAIEVGNITDAMNALGVMLERGEDGVGKDVTQAKELYEHA
IERNNAMAMYNLGTLLERGENGVPRDVLRAKELYERAIEVGKTTLAMCSL
GWLLHRGEEGVPRDLRRAKELYEHAIEVGNNHWAMYNLGLLLQQGGEGVP
KDVKRSKELYERAIKEGNNAMAMCNLGLLLQRGEDGVPKDVRRAKDLFER
AIEVGISVYVMNALAVVLERGEGGMPKDVRLAQKLYERAIEEGRNTDAMY
KLGLLLQQGEDSVPKDVRRAMELYKRAIEEGRNTDAMYMLGDGVPKNGAR
AMKLYERAITEGNNAIAMYSLGLLLQQDEDGVPKDVKRAKDLFERAVEVG
NNVYAMNALAVVFERGEDGVGKDVRRAKELYERAIEEGSNVEAMYNLGTL
LERGDDGVGKDVRRAKELYERAIEEGSNVDAMYKLGTLLERDDDGVPRDV
IRAKELHERAIEVGKNAWAMSGFVVIPTWDRI* back to top
Annotated Terms
The following terms have been associated with this polypeptide:
|