prot_F-serratus_M_contig1059.581.1 (polypeptide) Fucus serratus male
Overview
Homology
BLAST of mRNA_F-serratus_M_contig1059.581.1 vs. uniprot
Match: A0A6H5KSF1_9PHAE (Uncharacterized protein n=2 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KSF1_9PHAE) HSP 1 Score: 68.2 bits (165), Expect = 5.090e-13 Identity = 33/52 (63.46%), Postives = 41/52 (78.85%), Query Frame = 0 Query: 16 GLTFVCLSRAKRLTDLLIEPMTFERLSKLGEKPTLRLRLREEERLRALAGET 67 GLTFVCLSRAKRL DL++EPM+F+R+ LG PT++ RL+EE RL LA T Sbjct: 51 GLTFVCLSRAKRLVDLMVEPMSFDRIGNLGNSPTMKARLQEEVRLGELAQST 102
BLAST of mRNA_F-serratus_M_contig1059.581.1 vs. uniprot
Match: A0A6H5KCP5_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KCP5_9PHAE) HSP 1 Score: 68.2 bits (165), Expect = 1.900e-12 Identity = 33/52 (63.46%), Postives = 41/52 (78.85%), Query Frame = 0 Query: 16 GLTFVCLSRAKRLTDLLIEPMTFERLSKLGEKPTLRLRLREEERLRALAGET 67 GLTFVCLSRAKRL DL++EPM+F+R+ LG PT++ RL+EE RL LA T Sbjct: 49 GLTFVCLSRAKRLVDLMVEPMSFDRIGNLGNSPTMKARLQEEVRLGELAQST 100
BLAST of mRNA_F-serratus_M_contig1059.581.1 vs. uniprot
Match: A0A6H5JMH2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JMH2_9PHAE) HSP 1 Score: 68.2 bits (165), Expect = 1.930e-12 Identity = 33/52 (63.46%), Postives = 41/52 (78.85%), Query Frame = 0 Query: 16 GLTFVCLSRAKRLTDLLIEPMTFERLSKLGEKPTLRLRLREEERLRALAGET 67 GLTFVCLSRAKRL DL++EPM+F+R+ LG PT++ RL+EE RL LA T Sbjct: 115 GLTFVCLSRAKRLVDLMVEPMSFDRIGNLGNSPTMKARLQEEVRLGELAQST 166
BLAST of mRNA_F-serratus_M_contig1059.581.1 vs. uniprot
Match: A0A6H5JUS2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JUS2_9PHAE) HSP 1 Score: 68.2 bits (165), Expect = 7.570e-12 Identity = 33/52 (63.46%), Postives = 41/52 (78.85%), Query Frame = 0 Query: 16 GLTFVCLSRAKRLTDLLIEPMTFERLSKLGEKPTLRLRLREEERLRALAGET 67 GLTFVCLSRAKRL DL++EPM+F+R+ LG PT++ RL+EE RL LA T Sbjct: 222 GLTFVCLSRAKRLVDLMVEPMSFDRIGNLGNSPTMKARLQEEVRLGELAQST 273
BLAST of mRNA_F-serratus_M_contig1059.581.1 vs. uniprot
Match: A0A6H5KN08_9PHAE (Uncharacterized protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KN08_9PHAE) HSP 1 Score: 68.2 bits (165), Expect = 8.140e-12 Identity = 33/52 (63.46%), Postives = 41/52 (78.85%), Query Frame = 0 Query: 16 GLTFVCLSRAKRLTDLLIEPMTFERLSKLGEKPTLRLRLREEERLRALAGET 67 GLTFVCLSRAKRL DL++EPM+F+R+ LG PT++ RL+EE RL LA T Sbjct: 49 GLTFVCLSRAKRLVDLMVEPMSFDRIGNLGNSPTMKARLQEEVRLGELAQST 100
BLAST of mRNA_F-serratus_M_contig1059.581.1 vs. uniprot
Match: A0A6H5JFG8_9PHAE (Reverse transcriptase domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JFG8_9PHAE) HSP 1 Score: 68.2 bits (165), Expect = 1.230e-11 Identity = 33/52 (63.46%), Postives = 41/52 (78.85%), Query Frame = 0 Query: 16 GLTFVCLSRAKRLTDLLIEPMTFERLSKLGEKPTLRLRLREEERLRALAGET 67 GLTFVCLSRAKRL DL++EPM+F+R+ LG PT++ RL+EE RL LA T Sbjct: 396 GLTFVCLSRAKRLVDLMVEPMSFDRIGNLGNSPTMKARLQEEVRLGELAQST 447
BLAST of mRNA_F-serratus_M_contig1059.581.1 vs. uniprot
Match: A0A6H5K4U7_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K4U7_9PHAE) HSP 1 Score: 68.2 bits (165), Expect = 1.240e-11 Identity = 33/52 (63.46%), Postives = 41/52 (78.85%), Query Frame = 0 Query: 16 GLTFVCLSRAKRLTDLLIEPMTFERLSKLGEKPTLRLRLREEERLRALAGET 67 GLTFVCLSRAKRL DL++EPM+F+R+ LG PT++ RL+EE RL LA T Sbjct: 113 GLTFVCLSRAKRLVDLMVEPMSFDRIGNLGNSPTMKARLQEEVRLGELAQST 164
BLAST of mRNA_F-serratus_M_contig1059.581.1 vs. uniprot
Match: A0A6H5J8Y8_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5J8Y8_9PHAE) HSP 1 Score: 68.2 bits (165), Expect = 1.250e-11 Identity = 33/52 (63.46%), Postives = 41/52 (78.85%), Query Frame = 0 Query: 16 GLTFVCLSRAKRLTDLLIEPMTFERLSKLGEKPTLRLRLREEERLRALAGET 67 GLTFVCLSRAKRL DL++EPM+F+R+ LG PT++ RL+EE RL LA T Sbjct: 392 GLTFVCLSRAKRLVDLMVEPMSFDRIGNLGNSPTMKARLQEEVRLGELAQST 443
BLAST of mRNA_F-serratus_M_contig1059.581.1 vs. uniprot
Match: A0A6H5KFN2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KFN2_9PHAE) HSP 1 Score: 63.2 bits (152), Expect = 9.410e-11 Identity = 28/42 (66.67%), Postives = 36/42 (85.71%), Query Frame = 0 Query: 16 GLTFVCLSRAKRLTDLLIEPMTFERLSKLGEKPTLRLRLREE 57 GLTFVCLSRAKRL DL++EPM+F+R+ LG PT++ RL+EE Sbjct: 49 GLTFVCLSRAKRLVDLMVEPMSFDRIGNLGNSPTMKARLQEE 90
BLAST of mRNA_F-serratus_M_contig1059.581.1 vs. uniprot
Match: A0A6H5JGH7_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JGH7_9PHAE) HSP 1 Score: 65.1 bits (157), Expect = 1.530e-10 Identity = 29/43 (67.44%), Postives = 37/43 (86.05%), Query Frame = 0 Query: 16 GLTFVCLSRAKRLTDLLIEPMTFERLSKLGEKPTLRLRLREEE 58 GLTFVCLSRAKRL DL++EPM+F+R+ LG PT++ RL+EEE Sbjct: 469 GLTFVCLSRAKRLVDLMVEPMSFDRIGNLGNSPTMKARLQEEE 511 The following BLAST results are available for this feature:
BLAST of mRNA_F-serratus_M_contig1059.581.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Fucus serratus MALE vs UniRef90) Total hits: 25
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0 of Fucus serratus MALE
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_F-serratus_M_contig1059.581.1 ID=prot_F-serratus_M_contig1059.581.1|Name=mRNA_F-serratus_M_contig1059.581.1|organism=Fucus serratus male|type=polypeptide|length=76bpback to top |