prot_F-serratus_M_contig1054.559.1 (polypeptide) Fucus serratus male
Overview
Homology
BLAST of mRNA_F-serratus_M_contig1054.559.1 vs. uniprot
Match: D7FNY4_ECTSI (SH2 domain containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FNY4_ECTSI) HSP 1 Score: 62.0 bits (149), Expect = 4.720e-8 Identity = 28/55 (50.91%), Postives = 37/55 (67.27%), Query Frame = 0 Query: 116 DIICLETFASFCQWWWEPVMTTLSRICEEWASDNPVRVHGFIGRLEAKRKLLETD 170 D I +E FA F QWW P+++TL I +WA PVRVHGF+ RL AKR L++ + Sbjct: 755 DFISVEAFAKFSQWW-APLISTLGIIRNDWARTRPVRVHGFMSRLAAKRLLMQRE 808 The following BLAST results are available for this feature:
BLAST of mRNA_F-serratus_M_contig1054.559.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Fucus serratus MALE vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_F-serratus_M_contig1054.559.1 ID=prot_F-serratus_M_contig1054.559.1|Name=mRNA_F-serratus_M_contig1054.559.1|organism=Fucus serratus male|type=polypeptide|length=173bpback to top |