prot_F-serratus_M_contig1020.287.1 (polypeptide) Fucus serratus male
Overview
Homology
BLAST of mRNA_F-serratus_M_contig1020.287.1 vs. uniprot
Match: A0A6H5K7I7_9PHAE (F-box domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K7I7_9PHAE) HSP 1 Score: 69.3 bits (168), Expect = 6.640e-12 Identity = 31/43 (72.09%), Postives = 36/43 (83.72%), Query Frame = 0 Query: 243 SPIMWVIPNRTVHKIYSNLHPTDISQQVACVCQDWRQLAQDVP 285 SPI+WVIP V + +NLHPTD++Q VACVCQDWRQLAQDVP Sbjct: 10 SPILWVIPRGAVQNMMTNLHPTDLTQ-VACVCQDWRQLAQDVP 51 The following BLAST results are available for this feature:
BLAST of mRNA_F-serratus_M_contig1020.287.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Fucus serratus MALE vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Fucus serratus MALE
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_F-serratus_M_contig1020.287.1 ID=prot_F-serratus_M_contig1020.287.1|Name=mRNA_F-serratus_M_contig1020.287.1|organism=Fucus serratus male|type=polypeptide|length=285bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|