prot_F-serratus_M_contig1014.233.1 (polypeptide) Fucus serratus male
Overview
Homology
BLAST of mRNA_F-serratus_M_contig1014.233.1 vs. uniprot
Match: D7FQS3_ECTSI (F-box, zinc finger protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FQS3_ECTSI) HSP 1 Score: 92.8 bits (229), Expect = 9.560e-19 Identity = 49/86 (56.98%), Postives = 61/86 (70.93%), Query Frame = 0 Query: 69 EIDGRYRLVVSGLMNTLDACPAMPSETLAASLDDCLRRPS-ATATWSMRATPVLVRGVLSLVTRSPRSLCRAVVPVLVRFVTETEC 153 + +G + +VSGL LDACPAMP+ TL S++DCLRRPS A W+ +T + V GVLSLV+ SPRSLC+AVV VLVRFV C Sbjct: 10 QTNGPFLALVSGLQGALDACPAMPTLTLETSIEDCLRRPSPGAAVWAFGSTRMFVSGVLSLVSSSPRSLCQAVVSVLVRFVAGDGC 95 The following BLAST results are available for this feature:
BLAST of mRNA_F-serratus_M_contig1014.233.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Fucus serratus MALE vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_F-serratus_M_contig1014.233.1 ID=prot_F-serratus_M_contig1014.233.1|Name=mRNA_F-serratus_M_contig1014.233.1|organism=Fucus serratus male|type=polypeptide|length=174bpback to top |