prot_F-distichus_contig106405.548.1 (polypeptide) Fucus distichus monoicous

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview


Name	mRNA_F-distichus_contig106405.548.1
Unique Name	prot_F-distichus_contig106405.548.1
Type	polypeptide
Organism	Fucus distichus monoicous (Fucus distichus monoicous)
Sequence length	162

Homology

The following BLAST results are available for this feature:

BLAST of mRNA_F-distichus_contig106405.548.1 vs. uniprot

BLAST of mRNA_F-distichus_contig106405.548.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 0


Match Name	E-value	Identity	Description

InterPro

Analysis Name: OGS1.0 of Fucus distichus monoicous
Date Performed: 2021-02-24


IPR Term	IPR Description	Source	Source Term	Source Description	Alignment
None	No IPR available	PHOBIUS	NON_CYTOPLASMIC_DOMAIN	Non cytoplasmic domain	coord: 60..88
None	No IPR available	PHOBIUS	NON_CYTOPLASMIC_DOMAIN	Non cytoplasmic domain	coord: 1..5
None	No IPR available	PHOBIUS	TRANSMEMBRANE	Transmembrane region	coord: 34..59
None	No IPR available	PHOBIUS	TRANSMEMBRANE	Transmembrane region	coord: 89..109
None	No IPR available	PHOBIUS	CYTOPLASMIC_DOMAIN	Cytoplasmic domain	coord: 23..33
None	No IPR available	PHOBIUS	CYTOPLASMIC_DOMAIN	Cytoplasmic domain	coord: 110..161
None	No IPR available	PHOBIUS	TRANSMEMBRANE	Transmembrane region	coord: 6..22
None	No IPR available	TMHMM	TMhelix		coord: 5..22
None	No IPR available	TMHMM	TMhelix		coord: 35..57

Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29


IPR Term	IPR Description	Source	Source Term	Source Description	Alignment
None	No IPR available	PHOBIUS	NON_CYTOPLASMIC_DOMAIN	Non cytoplasmic domain	coord: 60..88
None	No IPR available	PHOBIUS	NON_CYTOPLASMIC_DOMAIN	Non cytoplasmic domain	coord: 1..5
None	No IPR available	PHOBIUS	TRANSMEMBRANE	Transmembrane region	coord: 34..59
None	No IPR available	PHOBIUS	TRANSMEMBRANE	Transmembrane region	coord: 89..109
None	No IPR available	PHOBIUS	CYTOPLASMIC_DOMAIN	Cytoplasmic domain	coord: 23..33
None	No IPR available	PHOBIUS	CYTOPLASMIC_DOMAIN	Cytoplasmic domain	coord: 110..161
None	No IPR available	PHOBIUS	TRANSMEMBRANE	Transmembrane region	coord: 6..22
None	No IPR available	TMHMM	TMhelix		coord: 5..22
None	No IPR available	TMHMM	TMhelix		coord: 35..57

Alignments

The following features are aligned


Aligned Feature	Feature Type	Alignment Location
F-distichus_contig106405	contig	F-distichus_contig106405:994..1479 +

Analyses

This polypeptide is derived from or has results from the following analyses


Analysis Name	Date Performed
InterProScan on OGS1.0	2022-09-29
Diamond blastp: OGS1.0 vs UniRef90	2022-09-16
OGS1.0 of Fucus distichus monoicous	2021-02-24

Relationships

This polypeptide derives from the following mRNA feature(s):


Feature Name	Unique Name	Species	Type	Position
mRNA_F-distichus_contig106405.548.1	mRNA_F-distichus_contig106405.548.1	Fucus distichus monoicous	mRNA	F-distichus_contig106405 949..1656 +

Sequences

The following sequences are available for this feature:

polypeptide sequence

polypeptide sequence

>prot_F-distichus_contig106405.548.1 ID=prot_F-distichus_contig106405.548.1|Name=mRNA_F-distichus_contig106405.548.1|organism=Fucus distichus monoicous|type=polypeptide|length=162bp
MDSSRLYLIVCTSIYISLYIIGRRHCYCERVNLQIAYALILWWKVSFINV
CVFWCGRALVVPDLLFVTLCNIIWHHTIPQGQRSKILDVVWVFRSVRPLP
TLFGIVFYLSKNPSPLSTRGCTGDFYLFSDRPYTLCPCPRVRSCVWYLHG
TCFVCAGSNHK*