prot_F-distichus_contig96781.19130.1 (polypeptide) Fucus distichus monoicous

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview


Name	mRNA_F-distichus_contig96781.19130.1
Unique Name	prot_F-distichus_contig96781.19130.1
Type	polypeptide
Organism	Fucus distichus monoicous (Fucus distichus monoicous)
Sequence length	128

Homology

[Close]

BLAST of mRNA_F-distichus_contig96781.19130.1 vs. uniprot
Match: A0A7S3HFS1_9STRA (Hypothetical protein n=1 Tax=Spumella elongata TaxID=89044 RepID=A0A7S3HFS1_9STRA)

HSP 1 Score: 68.9 bits (167), Expect = 2.710e-11
Identity = 40/108 (37.04%), Postives = 58/108 (53.70%), Query Frame = 0

Query:   20 RKWATFILLGPLLPSMFAILLVVVGRAIVKGDPIEADGHNACGQPLDIFIEAAIWVSYAFLAVFAWSFLGSKVTWSF--WGRRSWLLRPFYGLVIVAVQYMFLFAVSF 125
            +KWA  +L+GP LP++FA++++V G+ ++            CG  LD FI AA+ V Y FL VF+W ++G  V  S    G    LL PF  L  +   Y  +  VSF
Sbjct:   31 KKWAGLVLIGPFLPAVFALIVIVCGQLVLN------TWTGTCGYALDSFISAAVAVCYLFLMVFSWVYVGDTVILSLPALGIELTLLTPFKSLKYIVFYYFVVAVVSF 132

[Close]

BLAST of mRNA_F-distichus_contig96781.19130.1 vs. uniprot
Match: A0A7S1UGR8_9STRA (Hypothetical protein n=2 Tax=Phaeomonas parva TaxID=124430 RepID=A0A7S1UGR8_9STRA)

HSP 1 Score: 54.7 bits (130), Expect = 3.550e-6
Identity = 37/111 (33.33%), Postives = 55/111 (49.55%), Query Frame = 0

Query:   20 RKWATFILLGPLLPSMFAILLVVVGRAIVKGDPIEA------DGHNACGQPLDIFIEAAIWVSYAFLAVFAWSFLGSKVTWSFWGRRSWLLRPFYGLVIVAVQYMFLFAVS 124
            RKW+  ++ GPL  + FAI   +VG  ++    ++        G+NA    +  FI  AI VSY FL ++AW FLG K       R+  +LRP   L ++   Y  L  V+
Sbjct:   16 RKWSGVLIFGPLPWAFFAIFTTLVGSVLIHTAKLKCLDLFGDAGNNA--DNIANFIRGAIVVSYLFLMLYAWLFLGFKWDLKIMSRKYPVLRPIPNLAVLCTLYAILAVVT 124

The following BLAST results are available for this feature:

BLAST of mRNA_F-distichus_contig96781.19130.1 vs. uniprot

BLAST of mRNA_F-distichus_contig96781.19130.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 2


Match Name	E-value	Identity	Description
A0A7S3HFS1_9STRA	2.710e-11	37.04	Hypothetical protein n=1 Tax=Spumella elongata Tax...	[more]
A0A7S1UGR8_9STRA	3.550e-6	33.33	Hypothetical protein n=2 Tax=Phaeomonas parva TaxI...	[more]

InterPro

Analysis Name: OGS1.0 of Fucus distichus monoicous
Date Performed: 2021-02-24


IPR Term	IPR Description	Source	Source Term	Source Description	Alignment
None	No IPR available	PHOBIUS	NON_CYTOPLASMIC_DOMAIN	Non cytoplasmic domain	coord: 88..106
None	No IPR available	PHOBIUS	SIGNAL_PEPTIDE_N_REGION	Signal peptide N-region	coord: 1..6
None	No IPR available	PHOBIUS	TRANSMEMBRANE	Transmembrane region	coord: 67..87
None	No IPR available	PHOBIUS	SIGNAL_PEPTIDE_C_REGION	Signal peptide C-region	coord: 13..17
None	No IPR available	PHOBIUS	SIGNAL_PEPTIDE_H_REGION	Signal peptide H-region	coord: 7..12
None	No IPR available	PHOBIUS	TRANSMEMBRANE	Transmembrane region	coord: 107..126
None	No IPR available	PHOBIUS	SIGNAL_PEPTIDE	Signal Peptide	coord: 1..17
None	No IPR available	PHOBIUS	TRANSMEMBRANE	Transmembrane region	coord: 27..47
None	No IPR available	PHOBIUS	CYTOPLASMIC_DOMAIN	Cytoplasmic domain	coord: 127..127
None	No IPR available	PHOBIUS	CYTOPLASMIC_DOMAIN	Cytoplasmic domain	coord: 48..66
None	No IPR available	PHOBIUS	NON_CYTOPLASMIC_DOMAIN	Non cytoplasmic domain	coord: 18..26
None	No IPR available	TMHMM	TMhelix		coord: 67..89
None	No IPR available	TMHMM	TMhelix		coord: 25..47
None	No IPR available	TMHMM	TMhelix		coord: 101..123

Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29


IPR Term	IPR Description	Source	Source Term	Source Description	Alignment
None	No IPR available	PHOBIUS	NON_CYTOPLASMIC_DOMAIN	Non cytoplasmic domain	coord: 88..106
None	No IPR available	PHOBIUS	SIGNAL_PEPTIDE_N_REGION	Signal peptide N-region	coord: 1..6
None	No IPR available	PHOBIUS	TRANSMEMBRANE	Transmembrane region	coord: 67..87
None	No IPR available	PHOBIUS	SIGNAL_PEPTIDE_C_REGION	Signal peptide C-region	coord: 13..17
None	No IPR available	PHOBIUS	SIGNAL_PEPTIDE_H_REGION	Signal peptide H-region	coord: 7..12
None	No IPR available	PHOBIUS	TRANSMEMBRANE	Transmembrane region	coord: 107..126
None	No IPR available	PHOBIUS	SIGNAL_PEPTIDE	Signal Peptide	coord: 1..17
None	No IPR available	PHOBIUS	TRANSMEMBRANE	Transmembrane region	coord: 27..47
None	No IPR available	PHOBIUS	CYTOPLASMIC_DOMAIN	Cytoplasmic domain	coord: 127..127
None	No IPR available	PHOBIUS	CYTOPLASMIC_DOMAIN	Cytoplasmic domain	coord: 48..66
None	No IPR available	PHOBIUS	NON_CYTOPLASMIC_DOMAIN	Non cytoplasmic domain	coord: 18..26
None	No IPR available	TMHMM	TMhelix		coord: 67..89
None	No IPR available	TMHMM	TMhelix		coord: 25..47
None	No IPR available	TMHMM	TMhelix		coord: 101..123

Alignments

The following features are aligned


Aligned Feature	Feature Type	Alignment Location
F-distichus_contig96781	contig	F-distichus_contig96781:119..1076 -

Analyses

This polypeptide is derived from or has results from the following analyses


Analysis Name	Date Performed
InterProScan on OGS1.0	2022-09-29
Diamond blastp: OGS1.0 vs UniRef90	2022-09-16
OGS1.0 of Fucus distichus monoicous	2021-02-24

Relationships

This polypeptide derives from the following mRNA feature(s):


Feature Name	Unique Name	Species	Type	Position
mRNA_F-distichus_contig96781.19130.1	mRNA_F-distichus_contig96781.19130.1	Fucus distichus monoicous	mRNA	F-distichus_contig96781 119..1076 -

Sequences

The following sequences are available for this feature:

polypeptide sequence

polypeptide sequence

>prot_F-distichus_contig96781.19130.1 ID=prot_F-distichus_contig96781.19130.1|Name=mRNA_F-distichus_contig96781.19130.1|organism=Fucus distichus monoicous|type=polypeptide|length=128bp
MNDETKALAAALASCSAAQRKWATFILLGPLLPSMFAILLVVVGRAIVKG
DPIEADGHNACGQPLDIFIEAAIWVSYAFLAVFAWSFLGSKVTWSFWGRR
SWLLRPFYGLVIVAVQYMFLFAVSFGM*