prot_F-distichus_contig107001.595.1 (polypeptide) Fucus distichus monoicous

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview


Name	mRNA_F-distichus_contig107001.595.1
Unique Name	prot_F-distichus_contig107001.595.1
Type	polypeptide
Organism	Fucus distichus monoicous (Fucus distichus monoicous)
Sequence length	95

Homology

[Close]

BLAST of mRNA_F-distichus_contig107001.595.1 vs. uniprot
Match: UPI0010307233 (GIY-YIG nuclease family protein n=1 Tax=Rhizobium leguminosarum TaxID=384 RepID=UPI0010307233)

HSP 1 Score: 55.5 bits (132), Expect = 7.650e-7
Identity = 37/90 (41.11%), Postives = 47/90 (52.22%), Query Frame = 0

Query:    1 IYAIVNLKNGRAYVGRTIRSPFLRFQEHVMHDT----SYFGRALRHNP-NGFVVLLLEKVPDGTGLQEYRERESSWISRLDTLH-SGYNK 84
            IY I +   G+ YVG T+  P +RF +H +       S    A+R N    F + LLE V  G GL    ERES WI+ L+TLH  G NK
Sbjct:  213 IYRITDGSTGKCYVGLTVNKPEMRFGQHKIFANKGRGSLLHEAMRKNGFENFSIDLLEVVEGGEGL--LAERESHWITLLETLHPKGLNK 300

The following BLAST results are available for this feature:

BLAST of mRNA_F-distichus_contig107001.595.1 vs. uniprot

BLAST of mRNA_F-distichus_contig107001.595.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 1


Match Name	E-value	Identity	Description
UPI0010307233	7.650e-7	41.11	GIY-YIG nuclease family protein n=1 Tax=Rhizobium ...	[more]

InterPro

Analysis Name: OGS1.0 of Fucus distichus monoicous
Date Performed: 2021-02-24


IPR Term	IPR Description	Source	Source Term	Source Description	Alignment
IPR000305	GIY-YIG endonuclease	PFAM	PF01541	GIY-YIG	coord: 1..83 e-value: 2.8E-7 score: 30.7
IPR000305	GIY-YIG endonuclease	PROSITE	PS50164	GIY_YIG	coord: 1..84 score: 10.663
IPR035901	GIY-YIG endonuclease superfamily	GENE3D	3.40.1440.10		coord: 1..88 e-value: 5.1E-8 score: 35.1
IPR035901	GIY-YIG endonuclease superfamily	SUPERFAMILY	82771	GIY-YIG endonuclease	coord: 1..84

Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29


IPR Term	IPR Description	Source	Source Term	Source Description	Alignment
IPR000305	GIY-YIG endonuclease	PFAM	PF01541	GIY-YIG	coord: 1..83 e-value: 2.8E-7 score: 30.7
IPR000305	GIY-YIG endonuclease	PROSITE	PS50164	GIY_YIG	coord: 1..84 score: 10.663
IPR035901	GIY-YIG endonuclease superfamily	GENE3D	3.40.1440.10		coord: 1..88 e-value: 5.1E-8 score: 35.1
IPR035901	GIY-YIG endonuclease superfamily	SUPERFAMILY	82771	GIY-YIG endonuclease	coord: 1..84

Alignments

The following features are aligned


Aligned Feature	Feature Type	Alignment Location
F-distichus_contig107001	contig	F-distichus_contig107001:1229..1513 +

Analyses

This polypeptide is derived from or has results from the following analyses


Analysis Name	Date Performed
InterProScan on OGS1.0	2022-09-29
Diamond blastp: OGS1.0 vs UniRef90	2022-09-16
OGS1.0 of Fucus distichus monoicous	2021-02-24

Relationships

This polypeptide derives from the following mRNA feature(s):


Feature Name	Unique Name	Species	Type	Position
mRNA_F-distichus_contig107001.595.1	mRNA_F-distichus_contig107001.595.1	Fucus distichus monoicous	mRNA	F-distichus_contig107001 1229..1513 +

Sequences

The following sequences are available for this feature:

polypeptide sequence

polypeptide sequence

>prot_F-distichus_contig107001.595.1 ID=prot_F-distichus_contig107001.595.1|Name=mRNA_F-distichus_contig107001.595.1|organism=Fucus distichus monoicous|type=polypeptide|length=95bp
IYAIVNLKNGRAYVGRTIRSPFLRFQEHVMHDTSYFGRALRHNPNGFVVL
LLEKVPDGTGLQEYRERESSWISRLDTLHSGYNKRREIAKPAAPL

Annotated Terms

The following terms have been associated with this polypeptide:

Vocabulary: **INTERPRO**
Term	Definition
IPR000305	GIY-YIG_endonuc
IPR035901	GIY-YIG_endonuc_sf