EsuBft1022_2a-0001 (mRNA) Ectocarpus subulatus male Bft15b
You are viewing an mRNA, more information available on the corresponding polypeptide page
|
Overview
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following five_prime_UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following three_prime_UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
spliced messenger RNA >EsuBft1022_2a-0001 ID=EsuBft1022_2a-0001|Name=EsuBft1022_2a-0001|organism=Ectocarpus subulatus male Bft15b|type=mRNA|length=797bp|location=Sequence derived from alignment at Scaffold_103:244778..245574+ (Ectocarpus subulatus male Bft15b)|Notes=Excludes all bases but those of type(s): exon. GTGGTGCGTACGCGTGGGGACGGCAGCACGGAAGAGATCACGAACATCAAback to top protein sequence of EsuBft1022_2a-0001 >EsuBft1022_2 ID=EsuBft1022_2|Name=EsuBft1022_2a-0001|organism=Ectocarpus subulatus male Bft15b|type=polypeptide|length=123bp MSARVRDVCAAALRPGVERNNNLVNDGFSQSESPPKKTCGAASRRRYTSRback to top mRNA from alignment at Scaffold_103:244778..245574+ Legend: exonfive_prime_UTRpolypeptideCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.>EsuBft1022_2a-0001 ID=EsuBft1022_2a-0001|Name=EsuBft1022_2a-0001|organism=Ectocarpus subulatus male Bft15b|type=mRNA|length=797bp|location=Sequence derived from alignment at Scaffold_103:244778..245574+ (Ectocarpus subulatus male Bft15b)back to top Coding sequence (CDS) from alignment at Scaffold_103:244778..245574+ >EsuBft1022_2a-0001 ID=EsuBft1022_2a-0001|Name=EsuBft1022_2a-0001|organism=Ectocarpus subulatus male Bft15b|type=CDS|length=372bp|location=Sequence derived from alignment at Scaffold_103:244778..245574+ (Ectocarpus subulatus male Bft15b)back to top |