EsuBft100_12 (polypeptide) Ectocarpus subulatus male Bft15b

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of EsuBft100_12a-0001 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 25
ZOOM
x 1
POSITION
0
MSDVNELLIQPLQKFSKDSMHLIKKCTKPDRKEFMQVAKATTVGFLVMGFIGFFVKLVHIPINNILMAG102030405060Expect = 7.79e-41 / Id = 100.00Expect = 8.18e-34 / Id = 85.51Expect = 2.21e-31 / Id = 76.81Expect = 4.96e-31 / Id = 78.26Expect = 2.87e-30 / Id = 75.36Expect = 5.64e-30 / Id = 72.46Expect = 1.14e-29 / Id = 75.36Expect = 1.66e-29 / Id = 78.13Expect = 3.36e-29 / Id = 71.88Expect = 6.97e-29 / Id = 77.78SequenceD8LRT4_ECTSIA0A835YV57_9STRAW7U037_9STRAK3X8N9_GLOUDW4FU52_9STRAA0A067CAZ0_SAPPCM4BH76_HYAAEB5YLP6_THAPSA0A1Z5K738_FISSOB7FQV9_PHATC
Match NameE-valueIdentityDescription
D8LRT4_ECTSI7.790e-41100.00Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2... [more]
A0A835YV57_9STRA8.180e-3485.51Uncharacterized protein n=1 Tax=Tribonema minus Ta... [more]
W7U037_9STRA2.210e-3176.81Transport protein sec61 subunit gamma n=2 Tax=Mono... [more]
K3X8N9_GLOUD4.960e-3178.26Uncharacterized protein n=6 Tax=Oomycota TaxID=476... [more]
W4FU52_9STRA2.870e-3075.36Protein transporter Sec61 subunit gamma n=8 Tax=Oo... [more]
A0A067CAZ0_SAPPC5.640e-3072.46Translocase SEC61 complex gamma subunit n=2 Tax=Sa... [more]
M4BH76_HYAAE1.140e-2975.36Uncharacterized protein n=16 Tax=Peronosporaceae T... [more]
B5YLP6_THAPS1.660e-2978.13Predicted protein n=1 Tax=Thalassiosira pseudonana... [more]
A0A1Z5K738_FISSO3.360e-2971.88Protein transport protein SEC61 subunit gamma and ... [more]
B7FQV9_PHATC6.970e-2977.78Predicted protein n=2 Tax=Phaeodactylum tricornutu... [more]

Pages

back to top
BLAST of EsuBft100_12a-0001 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90)
Total hits: 25
ZOOM
x 1
POSITION
0
MSDVNELLIQPLQKFSKDSMHLIKKCTKPDRKEFMQVAKATTVGFLVMGFIGFFVKLVHIPINNILMAG102030405060Expect = 1.69e-35 / Id = 100.00Expect = 3.49e-29 / Id = 85.51Expect = 8.56e-28 / Id = 75.34Expect = 1.07e-26 / Id = 78.26Expect = 5.09e-26 / Id = 75.36Expect = 9.24e-26 / Id = 72.46Expect = 1.73e-25 / Id = 75.36Expect = 2.42e-25 / Id = 79.37Expect = 4.53e-25 / Id = 71.88Expect = 8.69e-25 / Id = 79.03SequenceD8LRT4_ECTSIA0A835YV57_9STRAW7U037_9STRAK3X8N9_GLOUDW4FU52_9STRAA0A067CAZ0_SAPPCM4BH76_HYAAEB5YLP6_THAPSA0A1Z5K738_FISSOB7FQV9_PHATC
Match NameE-valueIdentityDescription
D8LRT4_ECTSI1.690e-35100.00Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2... [more]
A0A835YV57_9STRA3.490e-2985.51Uncharacterized protein n=1 Tax=Tribonema minus Ta... [more]
W7U037_9STRA8.560e-2875.34Transport protein sec61 subunit gamma n=2 Tax=Mono... [more]
K3X8N9_GLOUD1.070e-2678.26Uncharacterized protein n=6 Tax=Oomycota TaxID=476... [more]
W4FU52_9STRA5.090e-2675.36Protein transporter Sec61 subunit gamma n=8 Tax=Oo... [more]
A0A067CAZ0_SAPPC9.240e-2672.46Translocase SEC61 complex gamma subunit n=2 Tax=Sa... [more]
M4BH76_HYAAE1.730e-2575.36Uncharacterized protein n=16 Tax=Peronosporaceae T... [more]
B5YLP6_THAPS2.420e-2579.37Predicted protein n=1 Tax=Thalassiosira pseudonana... [more]
A0A1Z5K738_FISSO4.530e-2571.88Protein transport protein SEC61 subunit gamma and ... [more]
B7FQV9_PHATC8.690e-2579.03Predicted protein n=2 Tax=Phaeodactylum tricornutu... [more]

Pages

back to top