EsuBft151_12 (polypeptide) Ectocarpus subulatus male Bft15b

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of EsuBft151_12a-0001 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 25
ZOOM
x 1
POSITION
0
MQIFVKAQSTITLGVEPTDTVDGVKQMIQEREGIPSCDQRLIFGGRQLEDELTLADYDMQKESTLHLVLRLRGGGKKRKKKTYTKPKKVKHVHKAVKLAVLKFYRVDDTGKVQRLRKSCPNEECGVGVRMAVHRNRFYCGKCGLTYVVTETKDAP20406080100120140Expect = 4.74e-107 / Id = 100.00Expect = 9.75e-70 / Id = 76.35Expect = 1.28e-67 / Id = 73.83Expect = 7.70e-67 / Id = 69.59Expect = 1.12e-66 / Id = 68.63Expect = 3.20e-66 / Id = 70.00Expect = 4.85e-66 / Id = 72.48Expect = 1.01e-65 / Id = 67.11Expect = 1.91e-65 / Id = 71.81Expect = 2.80e-65 / Id = 70.47SequenceA0A6H5JJB8_9PHAEA0A836CBR6_9STRAC1E561_MICCCH3G8T9_PHYRMA0A4D9DAQ5_9STRAA0A7S3HJV3_9STRAA9YTY9_SOLTUA0A507DVW0_9FUNGC1N2W9_MICPCR27AA_ARATH
Match NameE-valueIdentityDescription
A0A6H5JJB8_9PHAE4.740e-107100.00Ubiquitin-like domain-containing protein n=2 Tax=E... [more]
A0A836CBR6_9STRA9.750e-7076.35Ubiquitin n=1 Tax=Tribonema minus TaxID=303371 Rep... [more]
C1E561_MICCC1.280e-6773.83Ubiquitin-like domain-containing protein n=2 Tax=M... [more]
H3G8T9_PHYRM7.700e-6769.59Ubiquitin-like domain-containing protein n=26 Tax=... [more]
A0A4D9DAQ5_9STRA1.120e-6668.63Ubiquitin-like domain-containing protein n=2 Tax=M... [more]
A0A7S3HJV3_9STRA3.200e-6670.00Hypothetical protein n=1 Tax=Spumella elongata Tax... [more]
A9YTY9_SOLTU4.850e-6672.48Putative ubiquitin extension protein n=1 Tax=Solan... [more]
A0A507DVW0_9FUNG1.010e-6567.11Ubiquitin-like domain-containing protein n=7 Tax=C... [more]
C1N2W9_MICPC1.910e-6571.81Predicted protein n=1 Tax=Micromonas pusilla (stra... [more]
R27AA_ARATH2.800e-6570.47Ubiquitin-40S ribosomal protein S27a-1 n=48 Tax=ro... [more]

Pages

back to top
BLAST of EsuBft151_12a-0001 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90)
Total hits: 25
ZOOM
x 1
POSITION
0
MQIFVKAQSTITLGVEPTDTVDGVKQMIQEREGIPSCDQRLIFGGRQLEDELTLADYDMQKESTLHLVLRLRGGGKKRKKKTYTKPKKVKHVHKAVKLAVLKFYRVDDTGKVQRLRKSCPNEECGVGVRMAVHRNRFYCGKCGLTYVVTETKDAP20406080100120140Expect = 4.25e-105 / Id = 100.00Expect = 6.86e-68 / Id = 76.35Expect = 2.28e-66 / Id = 68.63Expect = 8.81e-66 / Id = 73.83Expect = 7.64e-65 / Id = 68.63Expect = 2.18e-64 / Id = 70.00Expect = 3.29e-64 / Id = 72.48Expect = 6.84e-64 / Id = 67.11Expect = 1.29e-63 / Id = 71.81Expect = 1.63e-63 / Id = 65.63SequenceA0A6H5JJB8_9PHAEA0A836CBR6_9STRAH3G8T9_PHYRMC1E561_MICCCA0A4D9DAQ5_9STRAA0A7S3HJV3_9STRAA9YTY9_SOLTUA0A507DVW0_9FUNGC1N2W9_MICPCA1CKM6_ASPCL
Match NameE-valueIdentityDescription
A0A6H5JJB8_9PHAE4.250e-105100.00Ubiquitin-like domain-containing protein n=2 Tax=E... [more]
A0A836CBR6_9STRA6.860e-6876.35Ubiquitin n=1 Tax=Tribonema minus TaxID=303371 Rep... [more]
H3G8T9_PHYRM2.280e-6668.63Ubiquitin-like domain-containing protein n=26 Tax=... [more]
C1E561_MICCC8.810e-6673.83Ubiquitin-like domain-containing protein n=2 Tax=M... [more]
A0A4D9DAQ5_9STRA7.640e-6568.63Ubiquitin-like domain-containing protein n=2 Tax=M... [more]
A0A7S3HJV3_9STRA2.180e-6470.00Hypothetical protein n=1 Tax=Spumella elongata Tax... [more]
A9YTY9_SOLTU3.290e-6472.48Putative ubiquitin extension protein n=1 Tax=Solan... [more]
A0A507DVW0_9FUNG6.840e-6467.11Ubiquitin-like domain-containing protein n=7 Tax=C... [more]
C1N2W9_MICPC1.290e-6371.81Predicted protein n=1 Tax=Micromonas pusilla (stra... [more]
A1CKM6_ASPCL1.630e-6365.63Ubiquitin n=1 Tax=Aspergillus clavatus (strain ATC... [more]

Pages

back to top