EsuBft981_15 (polypeptide) Ectocarpus subulatus male Bft15b
Overview
Homology
BLAST of EsuBft981_15a-0001 vs. uniprot
Match: A0A6H5L9V1_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L9V1_9PHAE) HSP 1 Score: 68.6 bits (166), Expect = 3.060e-9 Identity = 32/32 (100.00%), Postives = 32/32 (100.00%), Query Frame = 0 Query: 320 KMEAGVVFPPGLDRIEFVDTYRRVESGGEDSS 351 KMEAGVVFPPGLDRIEFVDTYRRVESGGEDSS Sbjct: 320 KMEAGVVFPPGLDRIEFVDTYRRVESGGEDSS 351
BLAST of EsuBft981_15a-0001 vs. uniprot
Match: D8LHW9_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LHW9_ECTSI) HSP 1 Score: 64.7 bits (156), Expect = 8.490e-8 Identity = 29/31 (93.55%), Postives = 30/31 (96.77%), Query Frame = 0 Query: 321 MEAGVVFPPGLDRIEFVDTYRRVESGGEDSS 351 MEAGVVFPPGLDR+EFVDTYRRVE GGEDSS Sbjct: 464 MEAGVVFPPGLDRVEFVDTYRRVEGGGEDSS 494
BLAST of EsuBft981_15a-0001 vs. uniprot
Match: A0A6H5L9V1_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L9V1_9PHAE) HSP 1 Score: 69.3 bits (168), Expect = 2.070e-9 Identity = 32/32 (100.00%), Postives = 32/32 (100.00%), Query Frame = 1 Query: 958 KMEAGVVFPPGLDRIEFVDTYRRVESGGEDSS 1053 KMEAGVVFPPGLDRIEFVDTYRRVESGGEDSS Sbjct: 320 KMEAGVVFPPGLDRIEFVDTYRRVESGGEDSS 351
BLAST of EsuBft981_15a-0001 vs. uniprot
Match: D8LHW9_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LHW9_ECTSI) HSP 1 Score: 65.5 bits (158), Expect = 5.880e-8 Identity = 29/31 (93.55%), Postives = 30/31 (96.77%), Query Frame = 1 Query: 961 MEAGVVFPPGLDRIEFVDTYRRVESGGEDSS 1053 MEAGVVFPPGLDR+EFVDTYRRVE GGEDSS Sbjct: 464 MEAGVVFPPGLDRVEFVDTYRRVEGGGEDSS 494 The following BLAST results are available for this feature:
BLAST of EsuBft981_15a-0001 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
BLAST of EsuBft981_15a-0001 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >EsuBft981_15 ID=EsuBft981_15|Name=EsuBft981_15a-0001|organism=Ectocarpus subulatus male Bft15b|type=polypeptide|length=351bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|