EsuBft1019_8 (polypeptide) Ectocarpus subulatus male Bft15b
Overview
Homology
BLAST of EsuBft1019_8a-0001 vs. uniprot
Match: A0A6H5J575_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5J575_9PHAE) HSP 1 Score: 109 bits (273), Expect = 1.350e-30 Identity = 54/54 (100.00%), Postives = 54/54 (100.00%), Query Frame = 0 Query: 1 MASGPPAGGIGELLGAFTSPDNGVRRRAEQAWEDMKMRLPDQEPQEEVQPPPPM 54 MASGPPAGGIGELLGAFTSPDNGVRRRAEQAWEDMKMRLPDQEPQEEVQPPPPM Sbjct: 1 MASGPPAGGIGELLGAFTSPDNGVRRRAEQAWEDMKMRLPDQEPQEEVQPPPPM 54
BLAST of EsuBft1019_8a-0001 vs. uniprot
Match: D7FNE2_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FNE2_ECTSI) HSP 1 Score: 87.0 bits (214), Expect = 1.150e-18 Identity = 41/42 (97.62%), Postives = 42/42 (100.00%), Query Frame = 0 Query: 1 MASGPPAGGIGELLGAFTSPDNGVRRRAEQAWEDMKMRLPDQ 42 MASGPPAGGIGELLGAFTSPDNGVRRRAE+AWEDMKMRLPDQ Sbjct: 1 MASGPPAGGIGELLGAFTSPDNGVRRRAEEAWEDMKMRLPDQ 42
BLAST of EsuBft1019_8a-0001 vs. uniprot
Match: A0A6H5J575_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5J575_9PHAE) HSP 1 Score: 110 bits (275), Expect = 6.970e-31 Identity = 54/54 (100.00%), Postives = 54/54 (100.00%), Query Frame = 1 Query: 1 MASGPPAGGIGELLGAFTSPDNGVRRRAEQAWEDMKMRLPDQEPQEEVQPPPPM 162 MASGPPAGGIGELLGAFTSPDNGVRRRAEQAWEDMKMRLPDQEPQEEVQPPPPM Sbjct: 1 MASGPPAGGIGELLGAFTSPDNGVRRRAEQAWEDMKMRLPDQEPQEEVQPPPPM 54
BLAST of EsuBft1019_8a-0001 vs. uniprot
Match: D7FNE2_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FNE2_ECTSI) HSP 1 Score: 87.8 bits (216), Expect = 6.460e-19 Identity = 41/42 (97.62%), Postives = 42/42 (100.00%), Query Frame = 1 Query: 1 MASGPPAGGIGELLGAFTSPDNGVRRRAEQAWEDMKMRLPDQ 126 MASGPPAGGIGELLGAFTSPDNGVRRRAE+AWEDMKMRLPDQ Sbjct: 1 MASGPPAGGIGELLGAFTSPDNGVRRRAEEAWEDMKMRLPDQ 42 The following BLAST results are available for this feature:
BLAST of EsuBft1019_8a-0001 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
BLAST of EsuBft1019_8a-0001 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >EsuBft1019_8 ID=EsuBft1019_8|Name=EsuBft1019_8a-0001|organism=Ectocarpus subulatus male Bft15b|type=polypeptide|length=54bpback to top |