Ec-00_002560.1 (mRNA) Ectocarpus species7 Ec32 male_plus_femaleSDR
Overview
Homology
BLAST of Ec-00_002560.1 vs. uniprot
Match: D7FL83_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FL83_ECTSI) HSP 1 Score: 112 bits (279), Expect = 1.830e-31 Identity = 55/55 (100.00%), Postives = 55/55 (100.00%), Query Frame = 1 Query: 1 MLKNAQVLAGELSSRMGKAVEDLRFDDSDKLTAGMKIEFSTILWGAKQISWYVFR 165 MLKNAQVLAGELSSRMGKAVEDLRFDDSDKLTAGMKIEFSTILWGAKQISWYVFR Sbjct: 1 MLKNAQVLAGELSSRMGKAVEDLRFDDSDKLTAGMKIEFSTILWGAKQISWYVFR 55
BLAST of Ec-00_002560.1 vs. uniprot
Match: D8LIV2_ECTSI (Queuosine salvage protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D8LIV2_ECTSI) HSP 1 Score: 66.2 bits (160), Expect = 2.430e-11 Identity = 35/43 (81.40%), Postives = 36/43 (83.72%), Query Frame = 1 Query: 1 MLKNAQVLAGELSSRMGKAVEDLRFDDSDKLTAGMKIEFSTIL 129 MLKNAQVLAGELSSRMGKAVEDLRFDDSDKLTA + T L Sbjct: 228 MLKNAQVLAGELSSRMGKAVEDLRFDDSDKLTAVADADVITAL 270 The following BLAST results are available for this feature:
BLAST of Ec-00_002560.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
mRNA sequence >Ec-00_002560.1 ID=Ec-00_002560.1|Name=Ec-00_002560.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=mRNA|length=56bpback to top spliced messenger RNA >Ec-00_002560.1 ID=Ec-00_002560.1|Name=Ec-00_002560.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=mRNA|length=168bp|location=Sequence derived from alignment at chr_00:2765919..2766591+ (Ectocarpus species7 Ec32 male_plus_femaleSDR)|Notes=Excludes all bases but those of type(s): exon. ATGCTCAAGAACGCTCAGGTGCTGGCGGGCGAGCTAAGCTCAAGGATGGGback to top protein sequence of Ec-00_002560.1 >Ec-00_002560.1 ID=Ec-00_002560.1|Name=Ec-00_002560.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=polypeptide|length=56bp MLKNAQVLAGELSSRMGKAVEDLRFDDSDKLTAGMKIEFSTILWGAKQISback to top mRNA from alignment at chr_00:2765919..2766591+ Legend: exonpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>Ec-00_002560.1 ID=Ec-00_002560.1|Name=Ec-00_002560.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=mRNA|length=673bp|location=Sequence derived from alignment at chr_00:2765919..2766591+ (Ectocarpus species7 Ec32 male_plus_femaleSDR)back to top Coding sequence (CDS) from alignment at chr_00:2765919..2766591+ >Ec-00_002560.1 ID=Ec-00_002560.1|Name=Ec-00_002560.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=CDS|length=168bp|location=Sequence derived from alignment at chr_00:2765919..2766591+ (Ectocarpus species7 Ec32 male_plus_femaleSDR)back to top Synonyms
The feature 'Ec-00_002560.1' has the following synonyms
|