Ec-00_002580.1 (polypeptide) Ectocarpus species7 Ec32 male_plus_femaleSDR
Overview
Homology
BLAST of Ec-00_002580.1 vs. uniprot
Match: D7G4V1_ECTSI (Peptidylprolyl isomerase n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G4V1_ECTSI) HSP 1 Score: 105 bits (263), Expect = 2.900e-26 Identity = 52/52 (100.00%), Postives = 52/52 (100.00%), Query Frame = 0 Query: 1 MVFNEQAKVLLMVANLLLPWSTRAFVLHCNANQRSVLGRHEGVVMMETLHGN 52 MVFNEQAKVLLMVANLLLPWSTRAFVLHCNANQRSVLGRHEGVVMMETLHGN Sbjct: 1 MVFNEQAKVLLMVANLLLPWSTRAFVLHCNANQRSVLGRHEGVVMMETLHGN 52
BLAST of Ec-00_002580.1 vs. uniprot
Match: A0A6H5JW52_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JW52_9PHAE) HSP 1 Score: 97.8 bits (242), Expect = 8.020e-24 Identity = 48/52 (92.31%), Postives = 49/52 (94.23%), Query Frame = 0 Query: 1 MVFNEQAKVLLMVANLLLPWSTRAFVLHCNANQRSVLGRHEGVVMMETLHGN 52 MV NEQAKVLLMV NLLLPWSTRAFVLHC+ANQRSVLGRHEGVVMME LHGN Sbjct: 1 MVLNEQAKVLLMVVNLLLPWSTRAFVLHCSANQRSVLGRHEGVVMMEMLHGN 52 The following BLAST results are available for this feature:
BLAST of Ec-00_002580.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Ec-00_002580.1 ID=Ec-00_002580.1|Name=Ec-00_002580.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=polypeptide|length=58bpback to top |