Ec-00_002230.1 (polypeptide) Ectocarpus species7 Ec32 male_plus_femaleSDR
Overview
Homology
BLAST of Ec-00_002230.1 vs. uniprot
Match: D7FX16_ECTSI (Protein kinase domain-containing protein n=2 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FX16_ECTSI) HSP 1 Score: 114 bits (286), Expect = 9.360e-28 Identity = 62/87 (71.26%), Postives = 66/87 (75.86%), Query Frame = 0 Query: 2 MTAPPPVVPEIFAFEGASTSVGQESSVLDRGTAAAATAAGGRGEMDLWAAALAPLPQDVFAPEVNMAGQCGPYGRRRPRLPCFMSFH 88 MTAPPP+VP FAFEGA T+ GQE +D G AAA AGG G +DLW ALAPLPQDVFAPEVNMA QCG YGRRR RLPCF S H Sbjct: 859 MTAPPPIVPGSFAFEGAGTAGGQEPWAIDLGMAAAG--AGGWG-IDLWVTALAPLPQDVFAPEVNMAVQCGRYGRRRRRLPCFASLH 942 The following BLAST results are available for this feature:
BLAST of Ec-00_002230.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Ec-00_002230.1 ID=Ec-00_002230.1|Name=Ec-00_002230.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=polypeptide|length=89bpback to top |