Ec-00_001390.1 (mRNA) Ectocarpus species7 Ec32 male_plus_femaleSDR
Overview
Homology
BLAST of Ec-00_001390.1 vs. uniprot
Match: D8LE94_ECTSI (Complex1_LYR_dom domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D8LE94_ECTSI) HSP 1 Score: 120 bits (301), Expect = 4.470e-34 Identity = 61/61 (100.00%), Postives = 61/61 (100.00%), Query Frame = 1 Query: 1 MGETDPVKIEALKGGAIRGLSNYLVHESGSNDPQLKKRMEAVKTHALADLKQRQQERDGKR 183 MGETDPVKIEALKGGAIRGLSNYLVHESGSNDPQLKKRMEAVKTHALADLKQRQQERDGKR Sbjct: 47 MGETDPVKIEALKGGAIRGLSNYLVHESGSNDPQLKKRMEAVKTHALADLKQRQQERDGKR 107
BLAST of Ec-00_001390.1 vs. uniprot
Match: A0A835Z7F8_9STRA (Complex1_LYR_dom domain-containing protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835Z7F8_9STRA) HSP 1 Score: 54.7 bits (130), Expect = 4.190e-8 Identity = 26/55 (47.27%), Postives = 36/55 (65.45%), Query Frame = 1 Query: 7 ETDPVKIEALKGGAIRGLSNYLVHESGSNDPQLKKRMEAVKTHALADLKQRQQER 171 ETDP ++ LK A+RGLSNY +HES S D +LK RME + A++ + Q+ R Sbjct: 50 ETDPARVAILKAAAVRGLSNYFLHESASRDAKLKARMEDQRIAVQAEIGEEQRAR 104
BLAST of Ec-00_001390.1 vs. uniprot
Match: A0A7S1ZML8_TRICV (Hypothetical protein n=1 Tax=Trieres chinensis TaxID=1514140 RepID=A0A7S1ZML8_TRICV) HSP 1 Score: 50.1 bits (118), Expect = 5.370e-6 Identity = 22/48 (45.83%), Postives = 32/48 (66.67%), Query Frame = 1 Query: 7 ETDPVKIEALKGGAIRGLSNYLVHESGSNDPQLKKRMEAVKTHALADL 150 E DP KIE++K GAIR LSNY+++ESG+ D +L K M ++ + Sbjct: 75 EKDPAKIESMKAGAIRALSNYMLYESGAKDQKLGKAMNKFNQDTISGI 122
BLAST of Ec-00_001390.1 vs. uniprot
Match: A0A024GHE4_9STRA (Phosphoribosylaminoimidazolesuccinocarboxamide synthase n=1 Tax=Albugo candida TaxID=65357 RepID=A0A024GHE4_9STRA) HSP 1 Score: 48.1 bits (113), Expect = 8.210e-5 Identity = 23/39 (58.97%), Postives = 28/39 (71.79%), Query Frame = 1 Query: 7 ETDPVKIEALKGGAIRGLSNYLVHESGSNDPQLKKRMEA 123 ETDP KIE LKG A+RGLSNYLV + S D +K M++ Sbjct: 82 ETDPEKIEMLKGNAVRGLSNYLVMANASKDKGMKNAMKS 120 The following BLAST results are available for this feature:
BLAST of Ec-00_001390.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 4
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
mRNA sequence >Ec-00_001390.1 ID=Ec-00_001390.1|Name=Ec-00_001390.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=mRNA|length=62bpback to top spliced messenger RNA >Ec-00_001390.1 ID=Ec-00_001390.1|Name=Ec-00_001390.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=mRNA|length=186bp|location=Sequence derived from alignment at chr_00:1611112..1612037- (Ectocarpus species7 Ec32 male_plus_femaleSDR)|Notes=Excludes all bases but those of type(s): exon. ATGGGCGAGACCGACCCAGTCAAGATAGAAGCGCTCAAGGGAGGCGCAATback to top protein sequence of Ec-00_001390.1 >Ec-00_001390.1 ID=Ec-00_001390.1|Name=Ec-00_001390.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=polypeptide|length=62bp MGETDPVKIEALKGGAIRGLSNYLVHESGSNDPQLKKRMEAVKTHALADLback to top mRNA from alignment at chr_00:1611112..1612037- Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.>Ec-00_001390.1 ID=Ec-00_001390.1|Name=Ec-00_001390.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=mRNA|length=926bp|location=Sequence derived from alignment at chr_00:1611112..1612037- (Ectocarpus species7 Ec32 male_plus_femaleSDR)back to top Coding sequence (CDS) from alignment at chr_00:1611112..1612037- >Ec-00_001390.1 ID=Ec-00_001390.1|Name=Ec-00_001390.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=CDS|length=186bp|location=Sequence derived from alignment at chr_00:1611112..1612037- (Ectocarpus species7 Ec32 male_plus_femaleSDR)back to top Synonyms
The feature 'Ec-00_001390.1' has the following synonyms
|