Ec-28_003820.1 (polypeptide) Ectocarpus species7 Ec32 male_plus_femaleSDR
Overview
Homology
BLAST of Ec-28_003820.1 vs. uniprot
Match: D7G060_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G060_ECTSI) HSP 1 Score: 59.7 bits (143), Expect = 2.040e-10 Identity = 29/37 (78.38%), Postives = 30/37 (81.08%), Query Frame = 0 Query: 1 MMVDDGTTINGIMIDAPEQDNSGDPAGVLSHMHTLRC 37 MMVDDGTTINGIMIDAPEQDNSGDPAG + H C Sbjct: 1 MMVDDGTTINGIMIDAPEQDNSGDPAGFPATWHGPPC 37
BLAST of Ec-28_003820.1 vs. uniprot
Match: D8LTK1_ECTSI (Metacapase n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LTK1_ECTSI) HSP 1 Score: 48.5 bits (114), Expect = 8.920e-5 Identity = 22/26 (84.62%), Postives = 22/26 (84.62%), Query Frame = 0 Query: 2 MVDDGTTINGIMIDAPEQDNSGDPAG 27 M DDGTTING MID PEQDNSGDP G Sbjct: 1 MEDDGTTINGTMIDGPEQDNSGDPPG 26 The following BLAST results are available for this feature:
BLAST of Ec-28_003820.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Ec-28_003820.1 ID=Ec-28_003820.1|Name=Ec-28_003820.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=polypeptide|length=71bpback to top |