Ec-00_003700.1 (polypeptide) Ectocarpus species7 Ec32 male_plus_femaleSDR
Overview
Homology
BLAST of Ec-00_003700.1 vs. uniprot
Match: D7FSJ8_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FSJ8_ECTSI) HSP 1 Score: 87.8 bits (216), Expect = 8.210e-19 Identity = 46/46 (100.00%), Postives = 46/46 (100.00%), Query Frame = 0 Query: 249 MAPTTRGKRTPSAKAKAAFATASTGATPTKNTTSPKNGKGKVHHPH 294 MAPTTRGKRTPSAKAKAAFATASTGATPTKNTTSPKNGKGKVHHPH Sbjct: 1 MAPTTRGKRTPSAKAKAAFATASTGATPTKNTTSPKNGKGKVHHPH 46
BLAST of Ec-00_003700.1 vs. uniprot
Match: UPI00178775DE (uncharacterized protein LOC118751219 n=1 Tax=Rhagoletis pomonella TaxID=28610 RepID=UPI00178775DE) HSP 1 Score: 55.5 bits (132), Expect = 6.820e-5 Identity = 29/73 (39.73%), Postives = 34/73 (46.58%), Query Frame = 0 Query: 121 EETRRDQGITAQTGDPCRHCGGKLFAKESKGICCKNGKYILPRLPPLPPSLKESYDSPEPSAQRFRKESRMYN 193 ++ RD I C HC FAKES G+CC NGK +LP L P SL P + F K R YN Sbjct: 45 DDNERDVAI-GPMNKVCLHCHALKFAKESPGMCCSNGKIVLPSLIEAPESLLSYLSGTTPISNHFLKNIRKYN 116 The following BLAST results are available for this feature:
BLAST of Ec-00_003700.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Ec-00_003700.1 ID=Ec-00_003700.1|Name=Ec-00_003700.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=polypeptide|length=297bpback to top |