Ec-28_002480.1 (mRNA) Ectocarpus species7 Ec32 male_plus_femaleSDR
Overview
Homology
BLAST of Ec-28_002480.1 vs. uniprot
Match: A0A6H5KH43_9PHAE (Uncharacterized protein n=2 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KH43_9PHAE) HSP 1 Score: 84.7 bits (208), Expect = 1.490e-17 Identity = 41/49 (83.67%), Postives = 42/49 (85.71%), Query Frame = 1 Query: 52 APSLTNAFATWFRSVRSPSPASGGICRAVRAVSATLSSLVCPCFEMMHD 198 APS TN FATWF RSPSPA+GGICRAVRAVSATLSSLVCPCFE M D Sbjct: 376 APSSTNPFATWFHFARSPSPATGGICRAVRAVSATLSSLVCPCFERMDD 424
BLAST of Ec-28_002480.1 vs. uniprot
Match: D7G3B3_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G3B3_ECTSI) HSP 1 Score: 81.6 bits (200), Expect = 3.640e-17 Identity = 39/57 (68.42%), Postives = 46/57 (80.70%), Query Frame = 1 Query: 46 AAAPSLTNAFATWFRSVRSPSPASGGICRAVRAVSATLSSLVCPCFEMMHDEDDDND 216 A A TN F +WFRS RSPSP +G +CRA+RAVSATLSSLVCPCFE M+D D+D+D Sbjct: 178 APASRTTNGFVSWFRSPRSPSPGTGRMCRAMRAVSATLSSLVCPCFERMYDYDNDDD 234
BLAST of Ec-28_002480.1 vs. uniprot
Match: A0A6H5J4Q7_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5J4Q7_9PHAE) HSP 1 Score: 75.1 bits (183), Expect = 1.250e-14 Identity = 37/52 (71.15%), Postives = 43/52 (82.69%), Query Frame = 1 Query: 52 APSL--TNAFATWFRSVRSPSPASGGICRAVRAVSATLSSLVCPCFEMMHDE 201 AP+L TN F WFRS RSPSPA+G +CRA+RAV ATLSSLVCPCFE M+D+ Sbjct: 177 APALRTTNGFMAWFRSPRSPSPATGRMCRAMRAVLATLSSLVCPCFERMYDD 228 The following BLAST results are available for this feature:
BLAST of Ec-28_002480.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
mRNA sequence >Ec-28_002480.1 ID=Ec-28_002480.1|Name=Ec-28_002480.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=mRNA|length=75bpback to top spliced messenger RNA >Ec-28_002480.1 ID=Ec-28_002480.1|Name=Ec-28_002480.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=mRNA|length=225bp|location=Sequence derived from alignment at chr_28:2307758..2308910+ (Ectocarpus species7 Ec32 male_plus_femaleSDR)|Notes=Excludes all bases but those of type(s): exon. ATGAAGGGGGCCCGCGGCGGTGACGGCGGTGGCGGCGGTGACGACGCCGCback to top protein sequence of Ec-28_002480.1 >Ec-28_002480.1 ID=Ec-28_002480.1|Name=Ec-28_002480.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=polypeptide|length=75bp MKGARGGDGGGGGDDAAAPSLTNAFATWFRSVRSPSPASGGICRAVRAVSback to top mRNA from alignment at chr_28:2307758..2308910+ Legend: exonpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>Ec-28_002480.1 ID=Ec-28_002480.1|Name=Ec-28_002480.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=mRNA|length=1153bp|location=Sequence derived from alignment at chr_28:2307758..2308910+ (Ectocarpus species7 Ec32 male_plus_femaleSDR)back to top Coding sequence (CDS) from alignment at chr_28:2307758..2308910+ >Ec-28_002480.1 ID=Ec-28_002480.1|Name=Ec-28_002480.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=CDS|length=225bp|location=Sequence derived from alignment at chr_28:2307758..2308910+ (Ectocarpus species7 Ec32 male_plus_femaleSDR)back to top Synonyms
The feature 'Ec-28_002480.1' has the following synonyms
|