Ec-28_001090.1 (mRNA) Ectocarpus species7 Ec32 male_plus_femaleSDR
Overview
Homology
BLAST of Ec-28_001090.1 vs. uniprot
Match: A0A6H5KFI7_9PHAE (Aldose 1-epimerase n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KFI7_9PHAE) HSP 1 Score: 93.6 bits (231), Expect = 1.830e-19 Identity = 42/45 (93.33%), Postives = 44/45 (97.78%), Query Frame = -2 Query: 365 YAVCLETQHFPAAVNHEGWVESVLLQPGGKYLERTRHVFTVQGRS 499 YAVCLETQHFPAAVNHEGW+ESVLL+PG KYLERTRHVFTVQGRS Sbjct: 345 YAVCLETQHFPAAVNHEGWMESVLLKPGEKYLERTRHVFTVQGRS 389 The following BLAST results are available for this feature:
BLAST of Ec-28_001090.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following five_prime_UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
mRNA sequence >Ec-28_001090.1 ID=Ec-28_001090.1|Name=Ec-28_001090.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=mRNA|length=113bpback to top spliced messenger RNA >Ec-28_001090.1 ID=Ec-28_001090.1|Name=Ec-28_001090.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=mRNA|length=501bp|location=Sequence derived from alignment at chr_28:1056616..1057116- (Ectocarpus species7 Ec32 male_plus_femaleSDR)|Notes=Excludes all bases but those of type(s): exon. AGCTGGAGAACCTGAGGCTTAACCAAAGTCACACCAAGCTGATGGCTTCAback to top protein sequence of Ec-28_001090.1 >Ec-28_001090.1 ID=Ec-28_001090.1|Name=Ec-28_001090.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=polypeptide|length=113bp MRDPCMNSTVNAYALQALDISKRFYRSSGLIHPTYAIDDDKCANSLGLLVback to top mRNA from alignment at chr_28:1056616..1057116- Legend: exonfive_prime_UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>Ec-28_001090.1 ID=Ec-28_001090.1|Name=Ec-28_001090.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=mRNA|length=501bp|location=Sequence derived from alignment at chr_28:1056616..1057116- (Ectocarpus species7 Ec32 male_plus_femaleSDR)back to top Coding sequence (CDS) from alignment at chr_28:1056616..1057116- >Ec-28_001090.1 ID=Ec-28_001090.1|Name=Ec-28_001090.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=CDS|length=339bp|location=Sequence derived from alignment at chr_28:1056616..1057116- (Ectocarpus species7 Ec32 male_plus_femaleSDR)back to top Synonyms
The feature 'Ec-28_001090.1' has the following synonyms
|