Ec-00_005500.1 (mRNA) Ectocarpus species7 Ec32 male_plus_femaleSDR
Overview
Homology
BLAST of Ec-00_005500.1 vs. uniprot
Match: D7G6F5_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G6F5_ECTSI) HSP 1 Score: 98.2 bits (243), Expect = 5.900e-26 Identity = 41/42 (97.62%), Postives = 41/42 (97.62%), Query Frame = 2 Query: 2 WGYPGELISRALKKANMDWPGEDVFDPRQLTCRSWPVDVPGP 127 WGYPGELISRALKKANMDWPGEDVFDPRQLTC SWPVDVPGP Sbjct: 33 WGYPGELISRALKKANMDWPGEDVFDPRQLTCLSWPVDVPGP 74
BLAST of Ec-00_005500.1 vs. uniprot
Match: D7G196_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G196_ECTSI) HSP 1 Score: 91.3 bits (225), Expect = 1.370e-23 Identity = 42/42 (100.00%), Postives = 42/42 (100.00%), Query Frame = 1 Query: 1 MGLSRGAHLSRAEKGEHGLARGGRVRPPATDMPFMACGCSRS 126 MGLSRGAHLSRAEKGEHGLARGGRVRPPATDMPFMACGCSRS Sbjct: 1 MGLSRGAHLSRAEKGEHGLARGGRVRPPATDMPFMACGCSRS 42
BLAST of Ec-00_005500.1 vs. uniprot
Match: D7FIY3_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FIY3_ECTSI) HSP 1 Score: 74.3 bits (181), Expect = 1.030e-16 Identity = 36/42 (85.71%), Postives = 37/42 (88.10%), Query Frame = 1 Query: 1 MGLSRGAHLSRAEKGEHGLARGGRVRPPATDMPFMACGCSRS 126 MGLSRGA+LSRAEKGEHGLARGGRVRPPA MPFM GC RS Sbjct: 1 MGLSRGANLSRAEKGEHGLARGGRVRPPAIVMPFMGGGCFRS 42
BLAST of Ec-00_005500.1 vs. uniprot
Match: D7G5D1_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G5D1_ECTSI) HSP 1 Score: 60.8 bits (146), Expect = 3.990e-11 Identity = 24/26 (92.31%), Postives = 24/26 (92.31%), Query Frame = 2 Query: 50 MDWPGEDVFDPRQLTCRSWPVDVPGP 127 MDWPGEDVFDPRQL CRSW VDVPGP Sbjct: 1 MDWPGEDVFDPRQLACRSWAVDVPGP 26 The following BLAST results are available for this feature:
BLAST of Ec-00_005500.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 4
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
mRNA sequence >Ec-00_005500.1 ID=Ec-00_005500.1|Name=Ec-00_005500.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=mRNA|length=43bpback to top spliced messenger RNA >Ec-00_005500.1 ID=Ec-00_005500.1|Name=Ec-00_005500.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=mRNA|length=129bp|location=Sequence derived from alignment at chr_00:8785666..8786061- (Ectocarpus species7 Ec32 male_plus_femaleSDR)|Notes=Excludes all bases but those of type(s): exon. ATGGGGCTATCCCGGGGAGCTCATCTCTCGCGCGCTGAAAAAGGCGAACAback to top protein sequence of Ec-00_005500.1 >Ec-00_005500.1 ID=Ec-00_005500.1|Name=Ec-00_005500.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=polypeptide|length=43bp MGLSRGAHLSRAEKGEHGLARGGRVRPPATDMPFMACGCSRS*back to top mRNA from alignment at chr_00:8785666..8786061- Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.>Ec-00_005500.1 ID=Ec-00_005500.1|Name=Ec-00_005500.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=mRNA|length=396bp|location=Sequence derived from alignment at chr_00:8785666..8786061- (Ectocarpus species7 Ec32 male_plus_femaleSDR)back to top Coding sequence (CDS) from alignment at chr_00:8785666..8786061- >Ec-00_005500.1 ID=Ec-00_005500.1|Name=Ec-00_005500.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=CDS|length=129bp|location=Sequence derived from alignment at chr_00:8785666..8786061- (Ectocarpus species7 Ec32 male_plus_femaleSDR)back to top Synonyms
The feature 'Ec-00_005500.1' has the following synonyms
|