Ec-00_003870.1 (mRNA) Ectocarpus species7 Ec32 male_plus_femaleSDR
Overview
Homology
The following BLAST results are available for this feature:
BLAST of Ec-00_003870.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
mRNA sequence >Ec-00_003870.1 ID=Ec-00_003870.1|Name=Ec-00_003870.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=mRNA|length=41bpback to top spliced messenger RNA >Ec-00_003870.1 ID=Ec-00_003870.1|Name=Ec-00_003870.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=mRNA|length=123bp|location=Sequence derived from alignment at chr_00:4352264..4353176+ (Ectocarpus species7 Ec32 male_plus_femaleSDR)|Notes=Excludes all bases but those of type(s): exon. ATGAGGTTTAGAGGGCACAAGGCCGATCAAGAGCAGAAAGGCAACATACGback to top protein sequence of Ec-00_003870.1 >Ec-00_003870.1 ID=Ec-00_003870.1|Name=Ec-00_003870.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=polypeptide|length=41bp MRFRGHKADQEQKGNIRVRTRDEVTGPQSAESSAATRTTI*back to top mRNA from alignment at chr_00:4352264..4353176+ Legend: exonpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>Ec-00_003870.1 ID=Ec-00_003870.1|Name=Ec-00_003870.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=mRNA|length=913bp|location=Sequence derived from alignment at chr_00:4352264..4353176+ (Ectocarpus species7 Ec32 male_plus_femaleSDR)back to top Coding sequence (CDS) from alignment at chr_00:4352264..4353176+ >Ec-00_003870.1 ID=Ec-00_003870.1|Name=Ec-00_003870.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=CDS|length=123bp|location=Sequence derived from alignment at chr_00:4352264..4353176+ (Ectocarpus species7 Ec32 male_plus_femaleSDR)back to top Synonyms
The feature 'Ec-00_003870.1' has the following synonyms
|