Ec-00_003150.1 (mRNA) Ectocarpus species7 Ec32 male_plus_femaleSDR
Overview
Homology
BLAST of Ec-00_003150.1 vs. uniprot
Match: D7FU02_ECTSI (Signal transducer, putative n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FU02_ECTSI) HSP 1 Score: 90.5 bits (223), Expect = 1.110e-21 Identity = 44/48 (91.67%), Postives = 45/48 (93.75%), Query Frame = 1 Query: 1 METNFQREFVETEGFRRIADASELEQRENRLLRAGGFLPPDTPPSPSV 144 METNFQREFVETEGFRRI DA+ELEQRENRLLRAGGFLPPD PPSP V Sbjct: 127 METNFQREFVETEGFRRIVDAAELEQRENRLLRAGGFLPPDAPPSPCV 174
BLAST of Ec-00_003150.1 vs. uniprot
Match: A0A6H5K499_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K499_9PHAE) HSP 1 Score: 87.0 bits (214), Expect = 3.760e-21 Identity = 42/48 (87.50%), Postives = 45/48 (93.75%), Query Frame = 1 Query: 1 METNFQREFVETEGFRRIADASELEQRENRLLRAGGFLPPDTPPSPSV 144 METNFQREFVETEGFRRI DA+E EQRENRLL+AGGFLPPD+PPSP V Sbjct: 53 METNFQREFVETEGFRRIVDAAEQEQRENRLLQAGGFLPPDSPPSPCV 100
BLAST of Ec-00_003150.1 vs. uniprot
Match: A0A6H5JJQ0_9PHAE (RGS domain-containing protein n=3 Tax=Ectocarpus TaxID=2879 RepID=A0A6H5JJQ0_9PHAE) HSP 1 Score: 88.2 bits (217), Expect = 3.060e-19 Identity = 43/45 (95.56%), Postives = 44/45 (97.78%), Query Frame = 1 Query: 1 METNFQREFVETEGFRRIADASELEQRENRLLRAGGFLPPDTPPS 135 METNFQREFVETEGFRRI +ASELEQRENRLLRAGGFLPPDTPPS Sbjct: 410 METNFQREFVETEGFRRIVEASELEQRENRLLRAGGFLPPDTPPS 454
BLAST of Ec-00_003150.1 vs. uniprot
Match: D7FTZ9_ECTSI (RGS domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FTZ9_ECTSI) HSP 1 Score: 79.0 bits (193), Expect = 5.800e-16 Identity = 39/48 (81.25%), Postives = 41/48 (85.42%), Query Frame = 1 Query: 1 METNFQREFVETEGFRRIADASELEQRENRLLRAGGFLPPDTPPSPSV 144 ME F+ EFVETEGFRRIA+ASELEQRE RLLRAGGFLPP TPP P V Sbjct: 383 MEAEFKAEFVETEGFRRIANASELEQREKRLLRAGGFLPPSTPPGPCV 430
BLAST of Ec-00_003150.1 vs. uniprot
Match: D7FIS3_ECTSI (Similar to retinally abundant regulator of G-protein signaling hRGS-r n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FIS3_ECTSI) HSP 1 Score: 68.6 bits (166), Expect = 2.920e-12 Identity = 35/43 (81.40%), Postives = 37/43 (86.05%), Query Frame = 1 Query: 1 METNFQREFVETEGFRRIADASELEQRENRLLRAGGFLPPDTP 129 METNFQREFV TEGFRRIADASE+E RE RLLRAGG LP +P Sbjct: 219 METNFQREFVTTEGFRRIADASEVEHREIRLLRAGGMLPSASP 261
BLAST of Ec-00_003150.1 vs. uniprot
Match: A0A6H5KDM3_9PHAE (RGS domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KDM3_9PHAE) HSP 1 Score: 68.6 bits (166), Expect = 2.930e-12 Identity = 35/43 (81.40%), Postives = 37/43 (86.05%), Query Frame = 1 Query: 1 METNFQREFVETEGFRRIADASELEQRENRLLRAGGFLPPDTP 129 METNFQREFV TEGFRRIADASE+E RE RLLRAGG LP +P Sbjct: 250 METNFQREFVTTEGFRRIADASEVEHREIRLLRAGGMLPSASP 292
BLAST of Ec-00_003150.1 vs. uniprot
Match: A0A6H5K0N5_9PHAE (RGS domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K0N5_9PHAE) HSP 1 Score: 67.0 bits (162), Expect = 9.950e-12 Identity = 35/46 (76.09%), Postives = 37/46 (80.43%), Query Frame = 1 Query: 1 METNFQREFVETEGFRRIADASELEQRENRLLRAGGFLPPDTPPSP 138 METNFQR+FVETEGFRRI DASELEQRE RLLRA G L P +P Sbjct: 291 METNFQRDFVETEGFRRIVDASELEQREMRLLRAEGVLVPSASTTP 336
BLAST of Ec-00_003150.1 vs. uniprot
Match: D7FTZ7_ECTSI (Similar to regulator of G-protein signaling 16 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FTZ7_ECTSI) HSP 1 Score: 65.5 bits (158), Expect = 3.560e-11 Identity = 33/46 (71.74%), Postives = 37/46 (80.43%), Query Frame = 1 Query: 1 METNFQREFVETEGFRRIADASELEQRENRLLRAGGFLPPDTPPSP 138 METNFQR+F+ETEGFRRI DASELEQR+ RLLRA G L P +P Sbjct: 342 METNFQRDFIETEGFRRIVDASELEQRQMRLLRAEGVLVPSASTTP 387
BLAST of Ec-00_003150.1 vs. uniprot
Match: D7FU07_ECTSI (Signal transducer, putative n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FU07_ECTSI) HSP 1 Score: 63.5 bits (153), Expect = 6.520e-11 Identity = 33/45 (73.33%), Postives = 37/45 (82.22%), Query Frame = 1 Query: 1 METNFQREFVETEGFRRIADASELEQRENRLLRAGGFLPPDTPPS 135 METNFQ++FVETEGFRRIADAS LEQ+E RLLR GFL D P+ Sbjct: 137 METNFQQDFVETEGFRRIADASALEQQEIRLLRKEGFLVADASPT 181
BLAST of Ec-00_003150.1 vs. uniprot
Match: D7FTZ5_ECTSI (Signal transducer, putative n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FTZ5_ECTSI) HSP 1 Score: 64.3 bits (155), Expect = 9.130e-11 Identity = 33/47 (70.21%), Postives = 40/47 (85.11%), Query Frame = 1 Query: 1 METNFQREFVETEGFRRIADASELEQRENRLLRAGGFLPPDTPPSPS 141 METNFQ +FVETEGFRRI +A+ELEQR+ RLL+A GFL P+T SP+ Sbjct: 345 METNFQTDFVETEGFRRIVNAAELEQRQIRLLQAEGFLLPNTGTSPT 391 The following BLAST results are available for this feature:
BLAST of Ec-00_003150.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 14
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
mRNA sequence >Ec-00_003150.1 ID=Ec-00_003150.1|Name=Ec-00_003150.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=mRNA|length=49bpback to top spliced messenger RNA >Ec-00_003150.1 ID=Ec-00_003150.1|Name=Ec-00_003150.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=mRNA|length=147bp|location=Sequence derived from alignment at chr_00:3198313..3198893+ (Ectocarpus species7 Ec32 male_plus_femaleSDR)|Notes=Excludes all bases but those of type(s): exon. ATGGAGACCAACTTCCAGAGGGAGTTCGTAGAAACAGAGGGGTTCCGCCGback to top protein sequence of Ec-00_003150.1 >Ec-00_003150.1 ID=Ec-00_003150.1|Name=Ec-00_003150.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=polypeptide|length=49bp METNFQREFVETEGFRRIADASELEQRENRLLRAGGFLPPDTPPSPSV*back to top mRNA from alignment at chr_00:3198313..3198893+ Legend: exonpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>Ec-00_003150.1 ID=Ec-00_003150.1|Name=Ec-00_003150.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=mRNA|length=581bp|location=Sequence derived from alignment at chr_00:3198313..3198893+ (Ectocarpus species7 Ec32 male_plus_femaleSDR)back to top Coding sequence (CDS) from alignment at chr_00:3198313..3198893+ >Ec-00_003150.1 ID=Ec-00_003150.1|Name=Ec-00_003150.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=CDS|length=147bp|location=Sequence derived from alignment at chr_00:3198313..3198893+ (Ectocarpus species7 Ec32 male_plus_femaleSDR)back to top Synonyms
The feature 'Ec-00_003150.1' has the following synonyms
|