Ec-00_001270.1 (mRNA) Ectocarpus species7 Ec32 male_plus_femaleSDR
Overview
Homology
BLAST of Ec-00_001270.1 vs. uniprot
Match: A0A6H5KUU3_9PHAE (PRP1_N domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KUU3_9PHAE) HSP 1 Score: 65.5 bits (158), Expect = 3.800e-12 Identity = 32/35 (91.43%), Postives = 33/35 (94.29%), Query Frame = 3 Query: 123 GAPSNHVAGLGRGAVGFTKWSDIGPARTTLAELGA 227 GAPSNHVAGLGRGAVGFT SDIGPARTT+AELGA Sbjct: 16 GAPSNHVAGLGRGAVGFTNRSDIGPARTTIAELGA 50
BLAST of Ec-00_001270.1 vs. uniprot
Match: A0A6H5L0M8_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L0M8_9PHAE) HSP 1 Score: 60.1 bits (144), Expect = 2.590e-9 Identity = 33/42 (78.57%), Postives = 34/42 (80.95%), Query Frame = 3 Query: 105 TYQHCCGAPSNHVAGLGRGAVGFTKWSDIGPARTTLAELGAA 230 TY GAPSN+VAGLGRGAVGFT SDIGPART LAE GAA Sbjct: 13 TYN--AGAPSNYVAGLGRGAVGFTTRSDIGPARTPLAEPGAA 52
BLAST of Ec-00_001270.1 vs. uniprot
Match: A0A7S4D952_HETAK (Hypothetical protein (Fragment) n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A7S4D952_HETAK) HSP 1 Score: 52.0 bits (123), Expect = 5.980e-6 Identity = 26/34 (76.47%), Postives = 28/34 (82.35%), Query Frame = 3 Query: 129 PSNHVAGLGRGAVGFTKWSDIGPARTTLAELGAA 230 PSN+VAGLGRGAVGFT SDIGPART + GAA Sbjct: 18 PSNYVAGLGRGAVGFTTRSDIGPARTAAPQSGAA 51
BLAST of Ec-00_001270.1 vs. uniprot
Match: A0A5D6YDN0_9STRA (Uncharacterized protein n=1 Tax=Pythium brassicum TaxID=1485010 RepID=A0A5D6YDN0_9STRA) HSP 1 Score: 50.8 bits (120), Expect = 2.700e-5 Identity = 26/40 (65.00%), Postives = 30/40 (75.00%), Query Frame = 3 Query: 114 HCCGAPSNHVAGLGRGAVGFTKWSDIGPARTTLAELGAAA 233 + GAP+N+V GLGRGAVGFT SDIGPAR+ L G AA Sbjct: 12 YASGAPANYVPGLGRGAVGFTTRSDIGPARSPLTPEGLAA 51
BLAST of Ec-00_001270.1 vs. uniprot
Match: A0A7S1SXG7_9CHLO (Hypothetical protein (Fragment) n=1 Tax=Tetraselmis chuii TaxID=63592 RepID=A0A7S1SXG7_9CHLO) HSP 1 Score: 50.1 bits (118), Expect = 4.990e-5 Identity = 24/29 (82.76%), Postives = 25/29 (86.21%), Query Frame = 3 Query: 126 APSNHVAGLGRGAVGFTKWSDIGPARTTL 212 APSN+VAGLGRGA GFT SDIGPART L Sbjct: 25 APSNYVAGLGRGATGFTTRSDIGPARTAL 53
BLAST of Ec-00_001270.1 vs. uniprot
Match: K3WCC0_GLOUD (PRP1_N domain-containing protein n=1 Tax=Globisporangium ultimum (strain ATCC 200006 / CBS 805.95 / DAOM BR144) TaxID=431595 RepID=K3WCC0_GLOUD) HSP 1 Score: 50.1 bits (118), Expect = 5.040e-5 Identity = 25/40 (62.50%), Postives = 30/40 (75.00%), Query Frame = 3 Query: 114 HCCGAPSNHVAGLGRGAVGFTKWSDIGPARTTLAELGAAA 233 + GAP+N+V GLGRGAVGFT SDIGPAR +A G+ A Sbjct: 12 YASGAPANYVPGLGRGAVGFTTRSDIGPARAPMAPDGSGA 51
BLAST of Ec-00_001270.1 vs. uniprot
Match: F0VZ29_9STRA (Uncharacterized protein AlNc14C1G170 n=1 Tax=Albugo laibachii Nc14 TaxID=890382 RepID=F0VZ29_9STRA) HSP 1 Score: 49.3 bits (116), Expect = 9.420e-5 Identity = 28/45 (62.22%), Postives = 29/45 (64.44%), Query Frame = 3 Query: 114 HCCGAPSNHVAGLGRGAVGFTKWSDIGPARTTLAELGAAARLARP 248 H AP N+V GLGRGAVGFT SDIGPAR LA G A A P Sbjct: 34 HESDAPENYVPGLGRGAVGFTTRSDIGPARNPLAPEGLAVAGAGP 78 The following BLAST results are available for this feature:
BLAST of Ec-00_001270.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 7
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
mRNA sequence >Ec-00_001270.1 ID=Ec-00_001270.1|Name=Ec-00_001270.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=mRNA|length=90bpback to top spliced messenger RNA >Ec-00_001270.1 ID=Ec-00_001270.1|Name=Ec-00_001270.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=mRNA|length=270bp|location=Sequence derived from alignment at chr_00:1536748..1537713- (Ectocarpus species7 Ec32 male_plus_femaleSDR)|Notes=Excludes all bases but those of type(s): exon. ATGGCGATGCGAGGCTTGGGAAAGAAAACTCCTGCACAACCTACAGCAGTback to top protein sequence of Ec-00_001270.1 >Ec-00_001270.1 ID=Ec-00_001270.1|Name=Ec-00_001270.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=polypeptide|length=90bp MAMRGLGKKTPAQPTAVTVMRWKGPSQASSSGTAVRTNTAAVPLRTTSLVback to top mRNA from alignment at chr_00:1536748..1537713- Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.>Ec-00_001270.1 ID=Ec-00_001270.1|Name=Ec-00_001270.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=mRNA|length=966bp|location=Sequence derived from alignment at chr_00:1536748..1537713- (Ectocarpus species7 Ec32 male_plus_femaleSDR)back to top Coding sequence (CDS) from alignment at chr_00:1536748..1537713- >Ec-00_001270.1 ID=Ec-00_001270.1|Name=Ec-00_001270.1|organism=Ectocarpus species7 Ec32 male_plus_femaleSDR|type=CDS|length=270bp|location=Sequence derived from alignment at chr_00:1536748..1537713- (Ectocarpus species7 Ec32 male_plus_femaleSDR)back to top Synonyms
The feature 'Ec-00_001270.1' has the following synonyms
|